Western Blot (WB)
(Western Blot detection against Immunogen (38.61kD).)
Mouse anti-Human Elafin Monoclonal Antibody | anti-ELAFIN antibody
Elafin (PI3, SKALP, ESI, ELAFIN, Elafin Precursor, Elastase-specific Inhibitor, ESI, MGC13613, Peptidase Inhibitor 3, Protease Inhibitor WAP3, SKALP, Skin-derived Antileukoproteinase, WAP3, WAP Four-disulfide Core Domain Protein 14, WFDC14) (PE)
Gene Names
PI3; ESI; WAP3; SKALP; WFDC14; cementoin
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Elafin; Monoclonal Antibody; Elafin (PI3; SKALP; ESI; ELAFIN; Elafin Precursor; Elastase-specific Inhibitor; MGC13613; Peptidase Inhibitor 3; Protease Inhibitor WAP3; Skin-derived Antileukoproteinase; WAP3; WAP Four-disulfide Core Domain Protein 14; WFDC14) (PE); anti-ELAFIN antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G9
Specificity
Recognizes human PI3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ELAFIN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-118 from human PI3 (AAH10952) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (38.61kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.61kD).)
Testing Data
(Detection limit for recombinant GST tagged PI3 is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PI3 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-ELAFIN antibody
Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.
Product Categories/Family for anti-ELAFIN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
12,270 Da
NCBI Official Full Name
Homo sapiens peptidase inhibitor 3, skin-derived, mRNA
NCBI Official Synonym Full Names
peptidase inhibitor 3
NCBI Official Symbol
PI3
NCBI Official Synonym Symbols
ESI; WAP3; SKALP; WFDC14; cementoin
NCBI Protein Information
elafin
Protein Family
NCBI Description
This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. [provided by RefSeq, Oct 2014]
Research Articles on ELAFIN
Similar Products
Product Notes
The ELAFIN (Catalog #AAA6157618) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Elafin (PI3, SKALP, ESI, ELAFIN, Elafin Precursor, Elastase-specific Inhibitor, ESI, MGC13613, Peptidase Inhibitor 3, Protease Inhibitor WAP3, SKALP, Skin-derived Antileukoproteinase, WAP3, WAP Four-disulfide Core Domain Protein 14, WFDC14) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Elafin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ELAFIN for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Elafin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
