Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.9kD).)

Mouse anti-Human TRIB3 Monoclonal Antibody | anti-TRIB3 antibody

TRIB3 (Tribbles Homolog 3, TRB3, TRB-3, Neuronal Cell Death-inducible Putative Kinase, NIPK, p65-interacting Inhibitor of NF-kappa-B, C20orf97, SINK, SKIP3) APC

Gene Names
TRIB3; NIPK; SINK; TRB3; SKIP3; C20orf97
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRIB3; Monoclonal Antibody; TRIB3 (Tribbles Homolog 3; TRB3; TRB-3; Neuronal Cell Death-inducible Putative Kinase; NIPK; p65-interacting Inhibitor of NF-kappa-B; C20orf97; SINK; SKIP3) APC; anti-TRIB3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1H2
Specificity
Recognizes human TRIB3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
2283
Applicable Applications for anti-TRIB3 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa56-145 from human TRIB3 (AAH27484) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.9kD).)

Western Blot (WB)

(Western Blot analysis of TRIB3 expression in transfected 293T cell line by TRIB3 monoclonal antibody. Lane 1: TRIB3 transfected lysate (39.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TRIB3 expression in transfected 293T cell line by TRIB3 monoclonal antibody. Lane 1: TRIB3 transfected lysate (39.6kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TRIB3 on A-431 cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TRIB3 on A-431 cell. [antibody concentration 10ug/ml].)

Western Blot (WB)

(Western blot analysis of TRIB3 over-expressed 293 cell line, cotransfected with TRIB3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIB3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of TRIB3 over-expressed 293 cell line, cotransfected with TRIB3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIB3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-TRIB3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens tribbles homolog 3 (Drosophila), mRNA
NCBI Official Synonym Full Names
tribbles pseudokinase 3
NCBI Official Symbol
TRIB3
NCBI Official Synonym Symbols
NIPK; SINK; TRB3; SKIP3; C20orf97
NCBI Protein Information
tribbles homolog 3
Protein Family

NCBI Description

The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. Differential promoter usage and alternate splicing result in multiple transcript variants. [provided by RefSeq, Jul 2014]

Research Articles on TRIB3

Similar Products

Product Notes

The TRIB3 (Catalog #AAA6139613) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRIB3 (Tribbles Homolog 3, TRB3, TRB-3, Neuronal Cell Death-inducible Putative Kinase, NIPK, p65-interacting Inhibitor of NF-kappa-B, C20orf97, SINK, SKIP3) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIB3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIB3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIB3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.