Mouse anti-Human TOMM34 Monoclonal Antibody | anti-TOMM34 antibody

TOMM34 (Translocase of Outer Membrane 34 kDa Subunit, Mitochondrial Import Receptor Subunit TOM34, hTom34, HTOM34P, URCC3)

Cat. Num. AAA641883

• Reactivity: Human
• Applications: ELISA, Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: TOMM34; Monoclonal Antibody; TOMM34 (Translocase of Outer Membrane 34 kDa Subunit; Mitochondrial Import Receptor Subunit TOM34; hTom34; HTOM34P; URCC3); Anti -TOMM34 (Translocase of Outer Membrane 34 kDa Subunit; anti-TOMM34 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2B5
• Specificity: Recognizes human TOMM34.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH

• Applicable Applications for anti-TOMM34 antibody: ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA and Western Blot.; Dilution: Immunofluorescence: 30ug/ml
• Immunogen: Full length recombinant corresponding to aa1-310 from human TOMM34 (AAH01763) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (60.1kD).)

Western Blot (WB)

(TOMM34 monoclonal antibody Western Blot analysis of TOMM34 expression in Hela.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TOMM34 on HeLa cell. [antibody concentration 30ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged TOMM34 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-TOMM34 antibody

Antibodies; Abs to Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 48145647
• UniProt Accession #: Q15785; Q53GH9; Q6IBN7; Q9NTZ3
• Molecular Weight: 34,559 Da
• NCBI Official Full Name: TOMM34
• UniProt Protein Name: Mitochondrial import receptor subunit TOM34
• Protein Family: Mitochondrial import receptor
• UniProt Gene Name: TOMM34
• UniProt Synonym Gene Names: URCC3; hTom34
• UniProt Entry Name: TOM34_HUMAN

Uniprot Description

TOMM34: Plays a role in the import of cytosolically synthesized preproteins into mitochondria. Binds the mature portion of precursor proteins. Interacts with cellular components, and possesses weak ATPase activity. May be a chaperone-like protein that helps to keep newly synthesized precursors in an unfolded import compatible state. Belongs to the Tom34 family.

Protein type: Mitochondrial; Chaperone

Chromosomal Location of Human Ortholog: -

Cellular Component: nucleoplasm; mitochondrial outer membrane; membrane; cytoplasm; integral to membrane; nucleus

Molecular Function: heat shock protein binding

Biological Process: protein targeting to mitochondrion