Mouse anti-Human TNNT3 Monoclonal Antibody | anti-TNNT3 antibody

TNNT3 (Troponin T, Fast Skeletal Muscle, TnTf, Beta-TnTF, Fast Skeletal Muscle Troponin T, fTnT) (HRP)

Cat. Num. AAA6155468

• Gene Names: TNNT3; TNTF; DA2B2; beta-TnTF
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TNNT3; Monoclonal Antibody; TNNT3 (Troponin T; Fast Skeletal Muscle; TnTf; Beta-TnTF; Fast Skeletal Muscle Troponin T; fTnT) (HRP); anti-TNNT3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1F12
• Specificity: Recognizes human TNNT3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 1065

• Applicable Applications for anti-TNNT3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa161-258 from human TNNT3 (NP_006748) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Testing Data

(Detection limit for recombinant GST tagged TNNT3 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-TNNT3 antibody

Antibodies; Cardiac Markers

NCBI and Uniprot Product Information

• NCBI GI #: 1519315975
• NCBI GeneID: 7140
• NCBI Accession #: NM_006757.4
• NCBI GenBank Nucleotide #: NM_006757
• NCBI Official Full Name: Homo sapiens troponin T3, fast skeletal type (TNNT3), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: troponin T3, fast skeletal type
• NCBI Official Symbol: TNNT3
• NCBI Official Synonym Symbols: TNTF; DA2B2; beta-TnTF
• NCBI Protein Information: troponin T, fast skeletal muscle
• Protein Family: Troponin

NCBI Description

The binding of Ca(2+) to the trimeric troponin complex initiates the process of muscle contraction. Increased Ca(2+) concentrations produce a conformational change in the troponin complex that is transmitted to tropomyosin dimers situated along actin filaments. The altered conformation permits increased interaction between a myosin head and an actin filament which, ultimately, produces a muscle contraction. The troponin complex has protein subunits C, I, and T. Subunit C binds Ca(2+) and subunit I binds to actin and inhibits actin-myosin interaction. Subunit T binds the troponin complex to the tropomyosin complex and is also required for Ca(2+)-mediated activation of actomyosin ATPase activity. There are 3 different troponin T genes that encode tissue-specific isoforms of subunit T for fast skeletal-, slow skeletal-, and cardiac-muscle. This gene encodes fast skeletal troponin T protein; also known as troponin T type 3. Alternative splicing results in multiple transcript variants encoding additional distinct troponin T type 3 isoforms. A developmentally regulated switch between fetal/neonatal and adult troponin T type 3 isoforms occurs. Additional splice variants have been described but their biological validity has not been established. Mutations in this gene may cause distal arthrogryposis multiplex congenita type 2B (DA2B). [provided by RefSeq, Oct 2009]