Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CTNNB1 on HeLa cell. [antibody concentration 10ug/ml].)

Mouse anti-Human CTNNB1 Monoclonal Antibody | anti-CTNNB1 antibody

CTNNB1 (Catenin beta-1, Beta-catenin, CTNNB, OK/SW-cl.35, PRO2286) (Biotin)

Gene Names
CTNNB1; EVR7; CTNNB; MRD19; NEDSDV; armadillo
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CTNNB1; Monoclonal Antibody; CTNNB1 (Catenin beta-1; Beta-catenin; CTNNB; OK/SW-cl.35; PRO2286) (Biotin); anti-CTNNB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C9
Specificity
Recognizes human CTNNB1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
781
Applicable Applications for anti-CTNNB1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa682-781 from human CTNNB1 (AAH58926) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CTNNB1 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CTNNB1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CTNNB1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CTNNB1 is 0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of CTNNB1 over-expressed 293 cell line, cotransfected with CTNNB1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CTNNB1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of CTNNB1 over-expressed 293 cell line, cotransfected with CTNNB1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CTNNB1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between GSK3B and CTNNB1. HeLa cells were stained with GSK3B rabbit purified polyclonal 1:1200 and CTNNB1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between GSK3B and CTNNB1. HeLa cells were stained with GSK3B rabbit purified polyclonal 1:1200 and CTNNB1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between FLT1 and CTNNB1. Huh7 cells were stained with FLT1 rabbit purified polyclonal 1:1200 and CTNNB1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between FLT1 and CTNNB1. Huh7 cells were stained with FLT1 rabbit purified polyclonal 1:1200 and CTNNB1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of CTNNB1 expression in transfected 293T cell line by CTNNB1 monoclonal antibody. Lane 1: CTNNB1 transfected lysate (85.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CTNNB1 expression in transfected 293T cell line by CTNNB1 monoclonal antibody. Lane 1: CTNNB1 transfected lysate (85.5kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-CTNNB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Catenin (cadherin-associated protein), beta 1, 88kDa
NCBI Official Synonym Full Names
catenin beta 1
NCBI Official Symbol
CTNNB1
NCBI Official Synonym Symbols
EVR7; CTNNB; MRD19; NEDSDV; armadillo
NCBI Protein Information
catenin beta-1
UniProt Protein Name
Catenin beta-1
Protein Family
UniProt Gene Name
CTNNB1
UniProt Synonym Gene Names
CTNNB
UniProt Entry Name
CTNB1_HUMAN

NCBI Description

The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2016]

Uniprot Description

CTNNB1: a regulator of cell adhesion and a key downstream effector in the Wnt signaling pathway. Implicated early embryonic development and tumorigenesis. Phosphorylated and destabilized by CK1 and GSK-3beta. Stabilized cytoplasmic beta-catenin is a hallmark of a variety of cancers. Stabilized beta-catenin translocates to the nucleus, where it acts as a transcriptional activator of T-cell factor (TCF)-regulated genes. Interacts with the PDZ domain of TAX1BP3, inhibiting its transcriptional activity. Two alternatively spliced human isoforms have been described.

Protein type: Cell adhesion; Nuclear receptor co-regulator; Motility/polarity/chemotaxis; Transcription factor; Oncoprotein; Actin-binding

Chromosomal Location of Human Ortholog: 3p21

Cellular Component: centrosome; basolateral plasma membrane; fascia adherens; intercellular junction; beta-catenin destruction complex; cytosol; transcription factor complex; cell-cell adherens junction; membrane; lamellipodium; perinuclear region of cytoplasm; cytoplasm; synapse; dendritic shaft; lateral plasma membrane; spindle pole; focal adhesion; tight junction; catenin complex; cell cortex; Z disc; nucleoplasm; adherens junction; apical part of cell; microvillus membrane; plasma membrane; cell junction; nucleus

Molecular Function: protein C-terminus binding; transcription coactivator activity; protein phosphatase binding; transcription factor binding; ionotropic glutamate receptor binding; protein binding; signal transducer activity; enzyme binding; androgen receptor binding; cadherin binding; double-stranded DNA binding; protein complex binding; estrogen receptor binding; nitric-oxide synthase binding; SMAD binding; kinase binding; transcription factor activity; nuclear hormone receptor binding; alpha-catenin binding

Biological Process: regulation of myelination; regulation of centriole-centriole cohesion; protein heterooligomerization; positive regulation of apoptosis; regulation of fibroblast proliferation; positive regulation of transcription, DNA-dependent; cell maturation; negative regulation of chondrocyte differentiation; T cell differentiation in the thymus; positive regulation of fibroblast growth factor receptor signaling pathway; Wnt receptor signaling pathway through beta-catenin; osteoclast differentiation; cell-cell adhesion; positive regulation of endothelial cell differentiation; embryonic foregut morphogenesis; positive regulation of mesenchymal cell proliferation; regulation of cell fate specification; ectoderm development; synapse organization and biogenesis; male genitalia development; cell adhesion; bone resorption; response to drug; positive regulation of neuroblast proliferation; positive regulation of I-kappaB kinase/NF-kappaB cascade; transcription, DNA-dependent; regulation of smooth muscle cell proliferation; hair cell differentiation; negative regulation of protein sumoylation; patterning of blood vessels; genitalia morphogenesis; muscle cell differentiation; midgut development; smooth muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; embryonic digit morphogenesis; negative regulation of transcription, DNA-dependent; oocyte development; embryonic forelimb morphogenesis; negative regulation of osteoclast differentiation; glial cell fate determination; endodermal cell fate commitment; apoptosis; cell-matrix adhesion; neuron migration; cell fate specification; dorsal/ventral axis specification; positive regulation of histone H3-K4 methylation; negative regulation of transcription from RNA polymerase II promoter; embryonic hindlimb morphogenesis; response to estradiol stimulus; negative regulation of cell proliferation; central nervous system vasculogenesis; positive regulation of MAPKKK cascade; pancreas development; positive regulation of interferon type I production; fallopian tube development; proximal/distal pattern formation; layer formation in the cerebral cortex; negative regulation of mitotic cell cycle, embryonic; cell structure disassembly during apoptosis; Wnt receptor signaling pathway; hair follicle morphogenesis; thymus development; in utero embryonic development; regulation of T cell proliferation; embryonic axis specification; neural plate development; stem cell maintenance; synaptic vesicle transport; gastrulation with mouth forming second; liver development; regulation of angiogenesis; odontogenesis of dentine-containing teeth; negative regulation of oligodendrocyte differentiation; myoblast differentiation; Schwann cell proliferation; positive regulation of osteoblast differentiation; response to cadmium ion; ureteric bud branching; response to cytokine stimulus; androgen receptor signaling pathway; positive regulation of muscle cell differentiation; epithelial to mesenchymal transition; embryonic heart tube development; innate immune response; lens morphogenesis in camera-type eye; anterior/posterior axis specification

Disease: Pilomatrixoma; Mental Retardation, Autosomal Dominant 19; Ovarian Cancer; Colorectal Cancer; Hepatocellular Carcinoma

Research Articles on CTNNB1

Similar Products

Product Notes

The CTNNB1 ctnnb1 (Catalog #AAA6141404) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CTNNB1 (Catenin beta-1, Beta-catenin, CTNNB, OK/SW-cl.35, PRO2286) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTNNB1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CTNNB1 ctnnb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CTNNB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.