Western Blot (WB)
(Western Blot detection against Immunogen (35.57kD).)
Mouse anti-Human, Mouse TNFSF12 Monoclonal Antibody | anti-TNFSF12 antibody
TNFSF12 (Tumor Necrosis Factor Ligand Superfamily Member 12, APO3 Ligand, APO3L, DR3LG, TNF-related Weak Inducer of Apoptosis, TWEAK, UNQ181/PRO207) APC
Gene Names
TNFSF12; APO3L; DR3LG; TWEAK; TNLG4A
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TNFSF12; Monoclonal Antibody; TNFSF12 (Tumor Necrosis Factor Ligand Superfamily Member 12; APO3 Ligand; APO3L; DR3LG; TNF-related Weak Inducer of Apoptosis; TWEAK; UNQ181/PRO207) APC; anti-TNFSF12 antibody
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H3
Specificity
Recognizes human TNFSF12. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-TNFSF12 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa49-134 from TNFSF12 (AAH19047) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQADGGYTTCLRP
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (35.57kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (35.57kD).)
Testing Data
(Detection limit for recombinant GST tagged TNFSF12 is 0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TNFSF12 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-TNFSF12 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
36,589 Da
NCBI Official Full Name
Homo sapiens tumor necrosis factor (ligand) superfamily, member 12, mRNA
NCBI Official Synonym Full Names
tumor necrosis factor superfamily member 12
NCBI Official Symbol
TNFSF12
NCBI Official Synonym Symbols
APO3L; DR3LG; TWEAK; TNLG4A
NCBI Protein Information
tumor necrosis factor ligand superfamily member 12
Protein Family
NCBI Description
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution. This cytokine, which exists in both membrane-bound and secreted forms, can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. Alternative splicing results in multiple transcript variants. Some transcripts skip the last exon of this gene and continue into the second exon of the neighboring TNFSF13 gene; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13. [provided by RefSeq, Oct 2010]
Research Articles on TNFSF12
Similar Products
Product Notes
The TNFSF12 (Catalog #AAA6139548) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TNFSF12 (Tumor Necrosis Factor Ligand Superfamily Member 12, APO3 Ligand, APO3L, DR3LG, TNF-related Weak Inducer of Apoptosis, TWEAK, UNQ181/PRO207) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TNFSF12 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TNFSF12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TNFSF12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
