Mouse TLR10 Monoclonal Antibody | anti-TLR10 antibody

TLR10 (Toll-like Receptor 10, CD290, UNQ315/PRO358) (HRP)

Cat. Num. AAA6155430

• Gene Names: TLR10; CD290
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TLR10; Monoclonal Antibody; TLR10 (Toll-like Receptor 10; CD290; UNQ315/PRO358) (HRP); anti-TLR10 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A11
• Specificity: Recognizes human TLR10. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-TLR10 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-811 from human TLR10 (NP_112218.2) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHF
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (87.27kD).)

Western Blot (WB)

(TLR10 monoclonal antibody, Western Blot analysis of TLR10 expression in PC-12.)

Western Blot (WB)

(TLR10 monoclonal antibody, Western Blot analysis of TLR10 expression in Raw 264.7.)

Western Blot (WB)

(TLR10 monoclonal antibody. Western Blot analysis of TLR10 expression in NIH/3T3.)

Product Categories/Family for anti-TLR10 antibody

Antibodies; Toll Like Receptors (TLR)

NCBI and Uniprot Product Information

• NCBI GI #: 62865618
• NCBI GeneID: 81793
• NCBI Accession #: NP_112218.2
• NCBI GenBank Nucleotide #: NM_030956.3
• UniProt Accession #: Q9BXR5; Q32MI7; Q32MI8; Q5FWG4; Q6UXL3; A8K7L1; B3Y668; D1CS21; D1CS22
• Molecular Weight: 94,564 Da
• NCBI Official Full Name: toll-like receptor 10 isoform a
• NCBI Official Synonym Full Names: toll-like receptor 10
• NCBI Official Symbol: TLR10
• NCBI Official Synonym Symbols: CD290
• NCBI Protein Information: toll-like receptor 10
• UniProt Protein Name: Toll-like receptor 10
• Protein Family: Toll-like receptor
• UniProt Gene Name: TLR10
• UniProt Entry Name: TLR10_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is most highly expressed in lymphoid tissues such as spleen, lymph node, thymus, and tonsil. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene. [provided by RefSeq, Aug 2010]

Uniprot Description

TLR10: Participates in the innate immune response to microbial agents. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Belongs to the Toll-like receptor family.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4p14

Cellular Component: membrane; integral to membrane; plasma membrane

Molecular Function: transmembrane receptor activity

Biological Process: toll-like receptor 5 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; regulation of cytokine secretion; toll-like receptor signaling pathway; innate immune response; immune response; inflammatory response; positive regulation of inflammatory response; toll-like receptor 10 signaling pathway