Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Mouse anti-Human AZIN1 Monoclonal Antibody | anti-AZIN1 antibody

AZIN1 (Antizyme Inhibitor 1, AZI, Ornithine Decarboxylase Antizyme Inhibitor, OAZI, OAZIN, MGC3832, MGC691) (HRP)

Gene Names
AZIN1; AZI; AZI1; OAZI; AZIA1; OAZIN; ODC1L
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AZIN1; Monoclonal Antibody; AZIN1 (Antizyme Inhibitor 1; AZI; Ornithine Decarboxylase Antizyme Inhibitor; OAZI; OAZIN; MGC3832; MGC691) (HRP); anti-AZIN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8B9
Specificity
Recognizes human AZIN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
448
Applicable Applications for anti-AZIN1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa339-448 from human AZIN1 (NP_056962) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HKKYKEDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGITSDSMMKNFFFVPSCIQLSQEDSFSAE*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB)

(Western Blot analysis of AZIN1 expression in transfected 293T cell line by AZIN1 monoclonal antibody. Lane 1: AZIN1 transfected lysate (49.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AZIN1 expression in transfected 293T cell line by AZIN1 monoclonal antibody. Lane 1: AZIN1 transfected lysate (49.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged AZIN1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AZIN1 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-AZIN1 antibody
Regulates cellular polyamine homeostasis. Inhibits antizyme-dependent ornithine decarboxylase degradation by binding to antizyme.
Product Categories/Family for anti-AZIN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
antizyme inhibitor 1 isoform 1
NCBI Official Synonym Full Names
antizyme inhibitor 1
NCBI Official Symbol
AZIN1
NCBI Official Synonym Symbols
AZI; AZI1; OAZI; AZIA1; OAZIN; ODC1L
NCBI Protein Information
antizyme inhibitor 1
UniProt Protein Name
Antizyme inhibitor 1
Protein Family
UniProt Gene Name
AZIN1
UniProt Synonym Gene Names
OAZI; OAZIN; AZI
UniProt Entry Name
AZIN1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the antizyme inhibitor family, which plays a role in cell growth and proliferation by maintaining polyamine homeostasis within the cell. Antizyme inhibitors are homologs of ornithine decarboxylase (ODC, the key enzyme in polyamine biosynthesis) that have lost the ability to decarboxylase ornithine; however, retain the ability to bind to antizymes. Antizymes negatively regulate intracellular polyamine levels by binding to ODC and targeting it for degradation, as well as by inhibiting polyamine uptake. Antizyme inhibitors function as positive regulators of polyamine levels by sequestering antizymes and neutralizing their effect. This gene encodes antizyme inhibitor 1, the first member of this gene family that is ubiquitously expressed, and is localized in the nucleus and cytoplasm. Overexpression of antizyme inhibitor 1 gene has been associated with increased proliferation, cellular transformation and tumorigenesis. Gene knockout studies showed that homozygous mutant mice lacking functional antizyme inhibitor 1 gene died at birth with abnormal liver morphology. RNA editing of this gene, predominantly in the liver tissue, has been linked to the progression of hepatocellular carcinoma. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Sep 2014]

Uniprot Description

AZIN1: Regulates cellular polyamine homeostasis. Inhibits antizyme-dependent ornithine decarboxylase degradation by binding to antizyme. Belongs to the Orn/Lys/Arg decarboxylase class-II family. ODC antizyme inhibitor subfamily.

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 8q22.3

Cellular Component: nucleus; cytosol

Molecular Function: enzyme inhibitor activity; ornithine decarboxylase activator activity; catalytic activity

Biological Process: positive regulation of catalytic activity; polyamine biosynthetic process; negative regulation of catalytic activity; negative regulation of protein catabolic process; regulation of amino acid metabolic process

Research Articles on AZIN1

Similar Products

Product Notes

The AZIN1 azin1 (Catalog #AAA6151370) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AZIN1 (Antizyme Inhibitor 1, AZI, Ornithine Decarboxylase Antizyme Inhibitor, OAZI, OAZIN, MGC3832, MGC691) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AZIN1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AZIN1 azin1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AZIN1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.