Mouse anti-Human TIP120A Monoclonal Antibody

TIP120A (Cullin-associated NEDD8-dissociated Protein 1, Cullin-associated And Neddylation-dissociated Protein 1, p120 CAND1, TBP-interacting Protein TIP120A, TBP-interacting Protein of 120kD A, TIP120, KIAA0829, CAND1, DKFZp434M1414, FLJ10114, FLJ10929, F

Cat. Num. AAA6010272

• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: TIP120A; Monoclonal Antibody; TIP120A (Cullin-associated NEDD8-dissociated Protein 1; Cullin-associated And Neddylation-dissociated Protein 1; p120 CAND1; TBP-interacting Protein TIP120A; TBP-interacting Protein of 120kD A; TIP120; KIAA0829; CAND1; DKFZp434M1414; FLJ10114; FLJ10929; F; Anti -TIP120A (Cullin-associated NEDD8-dissociated Protein 1; anti-TIP120A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5D7
• Specificity: Recognizes human CAND1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE

• Applicable Applications for anti-TIP120A antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunofluorescence: 10ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Partial recombinant corresponding to aa1-101 from human CAND1 (NP_060918) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(CAND1 monoclonal antibody, Western Blot analysis of CAND1 expression in HeLa NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CAND1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CAND1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CAND1 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-TIP120A antibody

TIP120A enhances transcription from various types of promoters. It is regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. It prevents neddylation of CUL1 by physically blocking access to the neddylation site and disrupts interactions between CUL1 and SKP1A and between CUL1 and F-box proteins.

Product Categories/Family for anti-TIP120A antibody

Antibodies; Abs to Enzymes