Mouse anti-Human TIP120A Monoclonal Antibody | anti-TIP120A antibody

TIP120A (Cullin-associated NEDD8-dissociated Protein 1, Cullin-associated And Neddylation-dissociated Protein 1, p120 CAND1, TBP-interacting Protein TIP120A, TBP-interacting Protein of 120kD A, TIP120, KIAA0829, CAND1, DKFZp434M1414, FLJ10114, FLJ10929, F

Cat. Num. AAA6130351

• Gene Names: CAND1; TIP120; TIP120A
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TIP120A; Monoclonal Antibody; TIP120A (Cullin-associated NEDD8-dissociated Protein 1; Cullin-associated And Neddylation-dissociated Protein 1; p120 CAND1; TBP-interacting Protein TIP120A; TBP-interacting Protein of 120kD A; TIP120; KIAA0829; CAND1; DKFZp434M1414; FLJ10114; FLJ10929; F; anti-TIP120A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5D7
• Specificity: Recognizes human CAND1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-TIP120A antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-101 from human CAND1 (NP_060918) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(CAND1 monoclonal antibody, Western Blot analysis of CAND1 expression in HeLa NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CAND1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CAND1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CAND1 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-TIP120A antibody

Antibodies; Cullin

NCBI and Uniprot Product Information

• NCBI GI #: 21361794
• NCBI GeneID: 55832
• NCBI Accession #: NP_060918
• NCBI GenBank Nucleotide #: NM_018448
• UniProt Accession #: Q86VP6
• Molecular Weight: 136kDa
• NCBI Official Full Name: cullin-associated NEDD8-dissociated protein 1 isoform 1
• NCBI Official Synonym Full Names: cullin associated and neddylation dissociated 1
• NCBI Official Symbol: CAND1
• NCBI Official Synonym Symbols: TIP120; TIP120A
• NCBI Protein Information: cullin-associated NEDD8-dissociated protein 1
• UniProt Protein Name: Cullin-associated NEDD8-dissociated protein 1
• UniProt Gene Name: CAND1
• UniProt Synonym Gene Names: KIAA0829; TIP120; TIP120A; TBP-interacting protein 120A

NCBI Description

This gene encodes an essential regulator of Cullin-RING ubiquitin ligases, which are in involved in ubiquitinylation of proteins degraded by the Ub proteasome system. The encoded protein binds to unneddylated cullin-RING box protein complexes and acts as an inhibitor of cullin neddylation and of Skp1, cullin, and F box ubiquitin ligase complex assembly and activity. In mammalian cell culture, this protein predominantly localizes to the cytoplasm. Knockdown of this gene in preadipocytes results in blocked adipogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]

Uniprot Description

Key assembly factor of SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes that promotes the exchange of the substrate-recognition F-box subunit in SCF complexes, thereby playing a key role in the cellular repertoire of SCF complexes. Acts as a F-box protein exchange factor. The exchange activity of CAND1 is coupled with cycles of neddylation conjugation: in the deneddylated state, cullin-binding CAND1 binds CUL1-RBX1, increasing dissociation of the SCF complex and promoting exchange of the F-box protein. Probably plays a similar role in other cullin-RING E3 ubiquitin ligase complexes.