Mouse T Monoclonal Antibody | anti-TBXT antibody

T (T, Brachyury Homolog (mouse), MGC104817, TFT) (PE)

Cat. Num. AAA6184133

• Gene Names: TBXT; T; TFT; SAVA
• Applications: Western Blot
• Purity: Purified
• Synonyms: T; Monoclonal Antibody; T (T; Brachyury Homolog (mouse); MGC104817; TFT) (PE); TFT; anti-TBXT antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5C6
• Specificity: Recognizes T.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-TBXT antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: T (NP_003172, 222aa-320aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged T is approximately 0.03ng/ml as a capture antibody.)

Related Product Information for anti-TBXT antibody

The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells. [provided by RefSeq]

Product Categories/Family for anti-TBXT antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4507339
• NCBI GeneID: 6862
• NCBI Accession #: NP_003172
• NCBI GenBank Nucleotide #: NM_003181
• UniProt Accession #: O15178
• Molecular Weight: 47kDa
• NCBI Official Full Name: T-box transcription factor T isoform 1
• NCBI Official Synonym Full Names: T-box transcription factor T
• NCBI Official Symbol: TBXT
• NCBI Official Synonym Symbols: T; TFT; SAVA
• NCBI Protein Information: T-box transcription factor T; brachyury protein
• UniProt Protein Name: Brachyury protein
• Protein Family: THP3
• UniProt Gene Name: T
• UniProt Entry Name: BRAC_HUMAN

NCBI Description

The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells. Variation in this gene was associated with susceptibility to neural tube defects and chordoma. A mutation in this gene was found in a family with sacral agenesis with vertebral anomalies. [provided by RefSeq, Sep 2018]

Uniprot Description

Brachyury: Involved in the transcriptional regulation of genes required for mesoderm formation and differentiation. Binds to a palindromic site (called T site) and activates gene transcription when bound to such a site. Genetic variations in T are associated with susceptibility to neural tube defects (NTD). NTD are common congenital malformations. Spina bifida, which results from malformations in the caudal region of the neural tube, is compatible with life but associated with significant morbidity, including lower limb paralysis. T is involved in susceptibility to the development of chordoma (CHDM). Chordomas are rare, clinically malignant tumors derived from notochordal remnants. They occur along the length of the spinal axis, predominantly in the sphenooccipital, vertebral and sacrococcygeal regions. They are characterized by slow growth, local destruction of bone, extension into adjacent soft tissues and rarely, distant metastatic spread. Susceptibility to development of chordomas is due to a T gene duplication.

Protein type: Motility/polarity/chemotaxis; DNA-binding; Cell cycle regulation; Transcription factor

Chromosomal Location of Human Ortholog: 6q27

Cellular Component: cytoplasm; nuclear chromatin; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; heart morphogenesis; somitogenesis; neural plate morphogenesis; embryonic skeletal development; mesoderm migration; notochord formation; negative regulation of transcription from RNA polymerase II promoter; Wnt receptor signaling pathway through beta-catenin; signal transduction; BMP signaling pathway; determination of anterior/posterior axis, embryo; positive regulation of cell proliferation; neural tube closure; penetration of zona pellucida; mesoderm development; vasculogenesis

Disease: Neural Tube Defects; Sacral Agenesis With Vertebral Anomalies