Mouse anti-Human, Rat Syntaxin-1A Monoclonal Antibody | anti-STX1A antibody
Syntaxin-1A (Neuron-specific Antigen HPC-1, STX1A, STX1) (MaxLight 490)
Gene Names
STX1A; STX1; HPC-1; P35-1; SYN1A
Reactivity
Human, Rat
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Syntaxin-1A; Monoclonal Antibody; Syntaxin-1A (Neuron-specific Antigen HPC-1; STX1A; STX1) (MaxLight 490); anti-STX1A antibody
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B11-1A8
Specificity
Recognizes human STX1A. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
2072
Applicable Applications for anti-STX1A antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-252 from human STX1A with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRKS
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-STX1A antibody
NCBI and Uniprot Product Information
NCBI Description
This gene encodes a member of the syntaxin superfamily. Syntaxins are nervous system-specific proteins implicated in the docking of synaptic vesicles with the presynaptic plasma membrane. Syntaxins possess a single C-terminal transmembrane domain, a SNARE [Soluble NSF (N-ethylmaleimide-sensitive fusion protein)-Attachment protein REceptor] domain (known as H3), and an N-terminal regulatory domain (Habc). Syntaxins bind synaptotagmin in a calcium-dependent fashion and interact with voltage dependent calcium and potassium channels via the C-terminal H3 domain. This gene product is a key molecule in ion channel regulation and synaptic exocytosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2009]
Research Articles on STX1A
Similar Products
Product Notes
The STX1A (Catalog #AAA6203630) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Syntaxin-1A (Neuron-specific Antigen HPC-1, STX1A, STX1) (MaxLight 490) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Syntaxin-1A can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STX1A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Syntaxin-1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
