Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (STX1A rabbit polyclonal antibody. Western Blot analysis of STX1A expression in mouse liver.)

Rabbit Syntaxin-1A Polyclonal Antibody | anti-STX1A antibody

Syntaxin-1A (Neuron-specific Antigen HPC-1, STX1A, STX1) (AP)

Gene Names
STX1A; STX1; HPC-1; P35-1; SYN1A
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Syntaxin-1A; Polyclonal Antibody; Syntaxin-1A (Neuron-specific Antigen HPC-1; STX1A; STX1) (AP); anti-STX1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human STX1A. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
2074
Applicable Applications for anti-STX1A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human STX1A, aa1-251 (AAH03011.1).
Immunogen Sequence
MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRKS
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(STX1A rabbit polyclonal antibody. Western Blot analysis of STX1A expression in mouse liver.)

Western Blot (WB) (STX1A rabbit polyclonal antibody. Western Blot analysis of STX1A expression in mouse liver.)

Western Blot (WB)

(STX1A rabbit polyclonal antibody. Western Blot analysis of STX1A expression in rat brain.)

Western Blot (WB) (STX1A rabbit polyclonal antibody. Western Blot analysis of STX1A expression in rat brain.)

Western Blot (WB)

(Western Blot analysis of STX1A expression in transfected 293T cell line by STX1A polyclonal antibody. Lane 1: STX1A transfected lysate (29kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of STX1A expression in transfected 293T cell line by STX1A polyclonal antibody. Lane 1: STX1A transfected lysate (29kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-STX1A antibody
Synaptic vesicles store neurotransmitters that are released during calcium-regulated exocytosis. The specificity of neurotransmitter release requires the localization of both synaptic vesicles and calcium channels to the presynaptic active zone. Syntaxins function in this vesicle fusion process. Syntaxins also serve as a substrate for botulinum neurotoxin type C, a metalloprotease that blocks exocytosis and has high affinity for a molecular complex that includes the alpha-latrotoxin receptor (MIM 600565) which produces explosive exocytosis (Zhang et al., 1995 [PubMed 7622072]).[supplied by OMIM]
Product Categories/Family for anti-STX1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens syntaxin 1A (brain), mRNA
NCBI Official Synonym Full Names
syntaxin 1A
NCBI Official Symbol
STX1A
NCBI Official Synonym Symbols
STX1; HPC-1; P35-1; SYN1A
NCBI Protein Information
syntaxin-1A
Protein Family

NCBI Description

This gene encodes a member of the syntaxin superfamily. Syntaxins are nervous system-specific proteins implicated in the docking of synaptic vesicles with the presynaptic plasma membrane. Syntaxins possess a single C-terminal transmembrane domain, a SNARE [Soluble NSF (N-ethylmaleimide-sensitive fusion protein)-Attachment protein REceptor] domain (known as H3), and an N-terminal regulatory domain (Habc). Syntaxins bind synaptotagmin in a calcium-dependent fashion and interact with voltage dependent calcium and potassium channels via the C-terminal H3 domain. This gene product is a key molecule in ion channel regulation and synaptic exocytosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2009]

Research Articles on STX1A

Similar Products

Product Notes

The STX1A (Catalog #AAA6395796) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Syntaxin-1A (Neuron-specific Antigen HPC-1, STX1A, STX1) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Syntaxin-1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STX1A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Syntaxin-1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.