Mouse anti-Human, Rat Syntaxin-1A Monoclonal Antibody | anti-STX1A antibody

Syntaxin-1A (Neuron-specific Antigen HPC-1, STX1A, STX1) (HRP)

Cat. Num. AAA6155303

• Gene Names: STX1A; STX1; HPC-1; P35-1; SYN1A
• Reactivity: Human, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Syntaxin-1A; Monoclonal Antibody; Syntaxin-1A (Neuron-specific Antigen HPC-1; STX1A; STX1) (HRP); anti-STX1A antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1B11-1A8
• Specificity: Recognizes human STX1A. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 2072

• Applicable Applications for anti-STX1A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-252 from human STX1A with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRKS
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(STX1A monoclonal antibody. Western Blot analysis of STX1A expression in PC-12.)

Western Blot (WB)

(STX1A monoclonal antibody, Western Blot analysis of STX1A expression in IMR-32.)

Western Blot (WB)

(Western Blot analysis of STX1A expression in transfected 293T cell line by STX1A monoclonal antibody. Lane 1: STX1A transfected lysate (29kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STX1A on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged STX1A is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-STX1A antibody

Synaptic vesicles store neurotransmitters that are released during calcium-regulated exocytosis. The specificity of neurotransmitter release requires the localization of both synaptic vesicles and calcium channels to the presynaptic active zone. Syntaxins function in this vesicle fusion process. Syntaxins also serve as a substrate for botulinum neurotoxin type C, a metalloprotease that blocks exocytosis and has high affinity for a molecular complex that includes the alpha-latrotoxin receptor (MIM 600565) which produces explosive exocytosis (Zhang et al., 1995 [PubMed 7622072]). [supplied by OMIM]

Product Categories/Family for anti-STX1A antibody

Antibodies; Syntaxin; Synaptotagmin; Synaptophysin

NCBI and Uniprot Product Information

• NCBI GI #: 38197499
• NCBI GeneID: 6804
• NCBI Official Full Name: Homo sapiens syntaxin 1A (brain), mRNA
• NCBI Official Synonym Full Names: syntaxin 1A
• NCBI Official Symbol: STX1A
• NCBI Official Synonym Symbols: STX1; HPC-1; P35-1; SYN1A
• NCBI Protein Information: syntaxin-1A
• Protein Family: Syntaxin

NCBI Description

This gene encodes a member of the syntaxin superfamily. Syntaxins are nervous system-specific proteins implicated in the docking of synaptic vesicles with the presynaptic plasma membrane. Syntaxins possess a single C-terminal transmembrane domain, a SNARE [Soluble NSF (N-ethylmaleimide-sensitive fusion protein)-Attachment protein REceptor] domain (known as H3), and an N-terminal regulatory domain (Habc). Syntaxins bind synaptotagmin in a calcium-dependent fashion and interact with voltage dependent calcium and potassium channels via the C-terminal H3 domain. This gene product is a key molecule in ion channel regulation and synaptic exocytosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2009]