Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Mouse anti-Human SUMF2 Monoclonal Antibody | anti-SUMF2 antibody

SUMF2 (Sulfatase-modifying Factor 2, C-alpha-formylglycine-generating Enzyme 2, pFGE, PSEC0171, UNQ1968/PRO4500) (AP)

Gene Names
SUMF2; pFGE
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SUMF2; Monoclonal Antibody; SUMF2 (Sulfatase-modifying Factor 2; C-alpha-formylglycine-generating Enzyme 2; pFGE; PSEC0171; UNQ1968/PRO4500) (AP); anti-SUMF2 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B3
Specificity
Recognizes human SUMF2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
1990
Applicable Applications for anti-SUMF2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa26-126 from human SUMF2 (NP_056226) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAF*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(SUMF2 monoclonal antibody. Western Blot analysis of SUMF2 expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged SUMF2 is ~3ng/ml as a capture antibody.)

Product Categories/Family for anti-SUMF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens sulfatase modifying factor 2 (SUMF2), transcript variant 2, mRNA
NCBI Official Synonym Full Names
sulfatase modifying factor 2
NCBI Official Symbol
SUMF2
NCBI Official Synonym Symbols
pFGE
NCBI Protein Information
inactive C-alpha-formylglycine-generating enzyme 2
UniProt Protein Name
Sulfatase-modifying factor 2
UniProt Gene Name
SUMF2
UniProt Entry Name
SUMF2_HUMAN

NCBI Description

The catalytic sites of sulfatases are only active if they contain a unique amino acid, C-alpha-formylglycine (FGly). The FGly residue is posttranslationally generated from a cysteine by enzymes with FGly-generating activity. The gene described in this record is a member of the sulfatase-modifying factor family and encodes a protein with a DUF323 domain that localizes to the lumen of the endoplasmic reticulum. This protein has low levels of FGly-generating activity but can heterodimerize with another family member - a protein with high levels of FGly-generating activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

SUMF2: Lacks formyl-glycine generating activity and is unable to convert newly synthesized inactive sulfatases to their active form. Inhibits the activation of sulfatases by SUMF1. Belongs to the sulfatase-modifying factor family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 7q11.1

Cellular Component: endoplasmic reticulum lumen

Molecular Function: metal ion binding

Biological Process: cellular protein metabolic process; post-translational protein modification

Research Articles on SUMF2

Similar Products

Product Notes

The SUMF2 sumf2 (Catalog #AAA6134067) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SUMF2 (Sulfatase-modifying Factor 2, C-alpha-formylglycine-generating Enzyme 2, pFGE, PSEC0171, UNQ1968/PRO4500) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SUMF2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SUMF2 sumf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SUMF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual