Mouse anti-Human SUMF2 Monoclonal Antibody | anti-SUMF2 antibody

SUMF2 (Sulfatase-modifying Factor 2, C-alpha-formylglycine-generating Enzyme 2, pFGE, PSEC0171, UNQ1968/PRO4500) (HRP)

Cat. Num. AAA6155279

• Gene Names: SUMF2; pFGE
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SUMF2; Monoclonal Antibody; SUMF2 (Sulfatase-modifying Factor 2; C-alpha-formylglycine-generating Enzyme 2; pFGE; PSEC0171; UNQ1968/PRO4500) (HRP); anti-SUMF2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4B3
• Specificity: Recognizes human SUMF2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 1990

• Applicable Applications for anti-SUMF2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa26-126 from human SUMF2 (NP_056226) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAF*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(SUMF2 monoclonal antibody. Western Blot analysis of SUMF2 expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged SUMF2 is ~3ng/ml as a capture antibody.)

Product Categories/Family for anti-SUMF2 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 1677499540
• NCBI GeneID: 25870
• NCBI Accession #: NM_015411.4
• NCBI GenBank Nucleotide #: NM_015411
• UniProt Accession #: Q8NBJ7
• NCBI Official Full Name: Homo sapiens sulfatase modifying factor 2 (SUMF2), transcript variant 2, mRNA
• NCBI Official Synonym Full Names: sulfatase modifying factor 2
• NCBI Official Symbol: SUMF2
• NCBI Official Synonym Symbols: pFGE
• NCBI Protein Information: inactive C-alpha-formylglycine-generating enzyme 2
• UniProt Protein Name: Sulfatase-modifying factor 2
• Protein Family: Sulfatase-modifying factor
• UniProt Gene Name: SUMF2
• UniProt Entry Name: SUMF2_HUMAN

NCBI Description

The catalytic sites of sulfatases are only active if they contain a unique amino acid, C-alpha-formylglycine (FGly). The FGly residue is posttranslationally generated from a cysteine by enzymes with FGly-generating activity. The gene described in this record is a member of the sulfatase-modifying factor family and encodes a protein with a DUF323 domain that localizes to the lumen of the endoplasmic reticulum. This protein has low levels of FGly-generating activity but can heterodimerize with another family member - a protein with high levels of FGly-generating activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

SUMF2: Lacks formyl-glycine generating activity and is unable to convert newly synthesized inactive sulfatases to their active form. Inhibits the activation of sulfatases by SUMF1. Belongs to the sulfatase-modifying factor family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 7q11.1

Cellular Component: endoplasmic reticulum lumen

Molecular Function: metal ion binding

Biological Process: cellular protein metabolic process; post-translational protein modification