Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SULT2B1 monoclonal antibody. Western Blot analysis of SULT2B1 expression in MCF-7.)

Mouse anti-Human SULT2B1 Monoclonal Antibody | anti-SULT2B1 antibody

SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1, Alcohol Sulfotransferase, HSST2, Hydroxysteroid Sulfotransferase 2, ST2B1, Sulfotransferase 2B1) (HRP)

Gene Names
SULT2B1; HSST2; ARCI14
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SULT2B1; Monoclonal Antibody; SULT2B1 (Sulfotransferase Family; Cytosolic; 2B; Member 1; Alcohol Sulfotransferase; HSST2; Hydroxysteroid Sulfotransferase 2; ST2B1; Sulfotransferase 2B1) (HRP); anti-SULT2B1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E5
Specificity
Recognizes human SULT2B1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-SULT2B1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-91 from human SULT2B1 (NP_814444) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKSGTTWMIEIICLILKEGDPS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SULT2B1 monoclonal antibody. Western Blot analysis of SULT2B1 expression in MCF-7.)

Western Blot (WB) (SULT2B1 monoclonal antibody. Western Blot analysis of SULT2B1 expression in MCF-7.)

Testing Data

(Detection limit for recombinant GST tagged SULT2B1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SULT2B1 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-SULT2B1 antibody
SULT2B1 (Sulfotransferase 2B1; also ST2B1b and alcohol sulfotransferase) is a 45-48kD member of the sulfotransferase 1 family of enzymes. SULT2B1 is widely expressed, being found in platelets, stratum granulosum keratinocytes, breast and prostatic epithelium, and syncytiotrophoblast cells. SULT2B1 catalyzes the sulfonation of DHEA, a precursor for sex steroids, and cholesterol, which supports stratification of the epidermis. Human SULT2B1 is 365aa in length. There are PAPS binding sites between aa70-75 and 147-155, a myristoylation motif between aa255-259, and a Pro-rich region between aa305-364 that may extend enzyme half-life. There is one 43kD splice form (ST2B1a) that shows an eight aa substitution for aa1-23. It is expressed in fetal brain and generates pregnenolone sulfate, a steroid that modulates neurotransmitters. Full-length human SULT2B1b shares only 71% aa identity with mouse SULT2B1.
Product Categories/Family for anti-SULT2B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41.3 kDa (365aa), confirmed by MALDI-TOF.
NCBI Official Full Name
sulfotransferase family cytosolic 2B member 1 isoform b
NCBI Official Synonym Full Names
sulfotransferase family 2B member 1
NCBI Official Symbol
SULT2B1
NCBI Official Synonym Symbols
HSST2; ARCI14
NCBI Protein Information
sulfotransferase family cytosolic 2B member 1
UniProt Protein Name
Sulfotransferase family cytosolic 2B member 1
UniProt Gene Name
SULT2B1
UniProt Synonym Gene Names
HSST2; ST2B1; Sulfotransferase 2B1
UniProt Entry Name
ST2B1_HUMAN

NCBI Description

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies. Two alternatively spliced variants that encode different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

SULT2B1: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates hydroxysteroids like DHEA. Isoform 1 preferentially sulfonates cholesterol, and isoform 2 avidly sulfonates pregnenolone but not cholesterol. Belongs to the sulfotransferase 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.8.2.2; Lipid Metabolism - androgen and estrogen; Energy Metabolism - sulfur; Transferase

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: intracellular membrane-bound organelle; endoplasmic reticulum; cytoplasm; nucleus; cytosol

Molecular Function: protein binding; alcohol sulfotransferase activity; steroid sulfotransferase activity

Biological Process: steroid metabolic process; sulfate assimilation; xenobiotic metabolic process; 3'-phosphoadenosine 5'-phosphosulfate metabolic process

Research Articles on SULT2B1

Similar Products

Product Notes

The SULT2B1 sult2b1 (Catalog #AAA6155277) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1, Alcohol Sulfotransferase, HSST2, Hydroxysteroid Sulfotransferase 2, ST2B1, Sulfotransferase 2B1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SULT2B1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SULT2B1 sult2b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SULT2B1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.