Mouse anti-Human SULT2B1 Monoclonal Antibody | anti-SULT2B1 antibody

SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1, Alcohol Sulfotransferase, HSST2, Hydroxysteroid Sulfotransferase 2, ST2B1, Sulfotransferase 2B1) (PE)

Cat. Num. AAA6160580

• Gene Names: SULT2B1; HSST2; ARCI14
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SULT2B1; Monoclonal Antibody; SULT2B1 (Sulfotransferase Family; Cytosolic; 2B; Member 1; Alcohol Sulfotransferase; HSST2; Hydroxysteroid Sulfotransferase 2; ST2B1; Sulfotransferase 2B1) (PE); anti-SULT2B1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2E5
• Specificity: Recognizes human SULT2B1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-SULT2B1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-91 from human SULT2B1 (NP_814444) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKSGTTWMIEIICLILKEGDPS
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SULT2B1 monoclonal antibody. Western Blot analysis of SULT2B1 expression in MCF-7.)

Testing Data

(Detection limit for recombinant GST tagged SULT2B1 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-SULT2B1 antibody

SULT2B1 (Sulfotransferase 2B1; also ST2B1b and alcohol sulfotransferase) is a 45-48kD member of the sulfotransferase 1 family of enzymes. SULT2B1 is widely expressed, being found in platelets, stratum granulosum keratinocytes, breast and prostatic epithelium, and syncytiotrophoblast cells. SULT2B1 catalyzes the sulfonation of DHEA, a precursor for sex steroids, and cholesterol, which supports stratification of the epidermis. Human SULT2B1 is 365aa in length. There are PAPS binding sites between aa70-75 and 147-155, a myristoylation motif between aa255-259, and a Pro-rich region between aa305-364 that may extend enzyme half-life. There is one 43kD splice form (ST2B1a) that shows an eight aa substitution for aa1-23. It is expressed in fetal brain and generates pregnenolone sulfate, a steroid that modulates neurotransmitters. Full-length human SULT2B1b shares only 71% aa identity with mouse SULT2B1.

Product Categories/Family for anti-SULT2B1 antibody

Antibodies; Enzymes; Sulfotransferase

NCBI and Uniprot Product Information

• NCBI GI #: 31563386
• NCBI GeneID: 6820
• NCBI Accession #: NP_814444
• NCBI GenBank Nucleotide #: NM_177973
• UniProt Accession #: O00204; O00205; O75814
• Molecular Weight: 41.3 kDa (365aa), confirmed by MALDI-TOF.
• NCBI Official Full Name: sulfotransferase family cytosolic 2B member 1 isoform b
• NCBI Official Synonym Full Names: sulfotransferase family 2B member 1
• NCBI Official Symbol: SULT2B1
• NCBI Official Synonym Symbols: HSST2; ARCI14
• NCBI Protein Information: sulfotransferase family cytosolic 2B member 1
• UniProt Protein Name: Sulfotransferase family cytosolic 2B member 1
• Protein Family: Sulfotransferase family cytosolic
• UniProt Gene Name: SULT2B1
• UniProt Synonym Gene Names: HSST2; ST2B1; Sulfotransferase 2B1
• UniProt Entry Name: ST2B1_HUMAN

NCBI Description

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies. Two alternatively spliced variants that encode different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

SULT2B1: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates hydroxysteroids like DHEA. Isoform 1 preferentially sulfonates cholesterol, and isoform 2 avidly sulfonates pregnenolone but not cholesterol. Belongs to the sulfotransferase 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.8.2.2; Lipid Metabolism - androgen and estrogen; Energy Metabolism - sulfur; Transferase

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: intracellular membrane-bound organelle; endoplasmic reticulum; cytoplasm; nucleus; cytosol

Molecular Function: protein binding; alcohol sulfotransferase activity; steroid sulfotransferase activity

Biological Process: steroid metabolic process; sulfate assimilation; xenobiotic metabolic process; 3'-phosphoadenosine 5'-phosphosulfate metabolic process