Western Blot (WB)
(Host: RabbitTarget Name: TIMM13Sample Tissue: Mouse Mouse Small IntestineAntibody Dilution: 1ug/ml)
Rabbit Timm13 Polyclonal Antibody | anti-TIMM13 antibody
Timm13 antibody - N-terminal region
Gene Names
Timm13; Tim9; Timm9; D10Ertd378e
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Timm13; Polyclonal Antibody; Timm13 antibody - N-terminal region; anti-TIMM13 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGSDFGGTGGGKLDPGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKP
Sequence Length
95
Applicable Applications for anti-TIMM13 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TIMM13Sample Tissue: Mouse Mouse Small IntestineAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TIMM13Sample Tissue: Mouse Mouse Small IntestineAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-Timm13 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)
Western Blot (WB)
(WB Suggested Anti-Timm13 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)
Related Product Information for anti-TIMM13 antibody
This is a rabbit polyclonal antibody against Timm13. It was validated on Western Blot
Target Description: Timm13 is a mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. It is also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. It acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins.
Target Description: Timm13 is a mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. It is also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. It acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins.
Product Categories/Family for anti-TIMM13 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
mitochondrial import inner membrane translocase subunit Tim13
NCBI Official Synonym Full Names
translocase of inner mitochondrial membrane 13
NCBI Official Symbol
Timm13
NCBI Official Synonym Symbols
Tim9; Timm9; D10Ertd378e
NCBI Protein Information
mitochondrial import inner membrane translocase subunit Tim13
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit Tim13
UniProt Gene Name
Timm13
UniProt Synonym Gene Names
Tim13a; Timm13a
UniProt Entry Name
TIM13_MOUSE
Similar Products
Product Notes
The TIMM13 timm13 (Catalog #AAA3211933) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Timm13 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Timm13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TIMM13 timm13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGSDFGGTGG GKLDPGAIME QVKVQIAVAN AQELLQRMTD KCFRKCIGKP. It is sometimes possible for the material contained within the vial of "Timm13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
