Western Blot (WB)
(Western Blot detection against Immunogen (35.2kD).)
Mouse anti-Human STK40 Monoclonal Antibody | anti-STK40 antibody
STK40 (Serine/Threonine-Protein Kinase 40, SgK495, SINK-Homologous Serine/Threonine-Protein Kinase, Sugen Kinase 495, SGK495, SHIK, MGC4796) (AP)
Gene Names
STK40; SHIK; SgK495
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STK40; Monoclonal Antibody; STK40 (Serine/Threonine-Protein Kinase 40; SgK495; SINK-Homologous Serine/Threonine-Protein Kinase; Sugen Kinase 495; SGK495; SHIK; MGC4796) (AP); anti-STK40 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G3
Specificity
Recognizes human STK40.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-STK40 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa349-435 from human STK40 (NP_114406) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PDIDDQMSNADSSQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHDARSWVPKRQFGSAPPVRRLGHDAQPMTSLDTAILAQRYLR
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (35.2kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (35.2kD).)
Western Blot (WB)
(STK40 monoclonal antibody. Western Blot analysis of STK40 expression in HepG2.)
Western Blot (WB)
(STK40 monoclonal antibody. Western Blot analysis of STK40 expression in HepG2.)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to STK40 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml].)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to STK40 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml].)
Product Categories/Family for anti-STK40 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,459 Da
NCBI Official Full Name
serine/threonine-protein kinase 40 isoform 2
NCBI Official Synonym Full Names
serine/threonine kinase 40
NCBI Official Symbol
STK40
NCBI Official Synonym Symbols
SHIK; SgK495
NCBI Protein Information
serine/threonine-protein kinase 40; SINK-homologous serine/threonine-protein kinase; Ser/Thr-like kinase; sugen kinase 495
UniProt Protein Name
Serine/threonine-protein kinase 40
Protein Family
UniProt Gene Name
STK40
UniProt Synonym Gene Names
SGK495; SHIK; SgK495
UniProt Entry Name
STK40_HUMAN
Similar Products
Product Notes
The STK40 stk40 (Catalog #AAA6134041) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STK40 (Serine/Threonine-Protein Kinase 40, SgK495, SINK-Homologous Serine/Threonine-Protein Kinase, Sugen Kinase 495, SGK495, SHIK, MGC4796) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STK40 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STK40 stk40 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STK40, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
