Mouse anti-Human STK40 Monoclonal Antibody | anti-STK40 antibody

STK40 (Serine/Threonine-Protein Kinase 40, SgK495, SINK-Homologous Serine/Threonine-Protein Kinase, Sugen Kinase 495, SGK495, SHIK, MGC4796)

Cat. Num. AAA646318

• Gene Names: STK40; SHIK; SgK495
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: STK40; Monoclonal Antibody; STK40 (Serine/Threonine-Protein Kinase 40; SgK495; SINK-Homologous Serine/Threonine-Protein Kinase; Sugen Kinase 495; SGK495; SHIK; MGC4796); Anti -STK40 (Serine/Threonine-Protein Kinase 40; anti-STK40 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G3
• Specificity: Recognizes human STK40.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: PDIDDQMSNADSSQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHDARSWVPKRQFGSAPPVRRLGHDAQPMTSLDTAILAQRYLR

• Applicable Applications for anti-STK40 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
• Application Notes: Suitable for use in ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Partial recombinant corresponding to aa349-435 from human STK40 (NP_114406) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.2kD).)

Western Blot (WB)

(STK40 monoclonal antibody. Western Blot analysis of STK40 expression in HepG2.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to STK40 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml].)

Related Product Information for anti-STK40 antibody

STK40 may be a negative regulator of NF-kappa-B and p53-mediated gene transcription.

Product Categories/Family for anti-STK40 antibody

Antibodies; Abs to Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 543173142
• NCBI GeneID: 83931
• NCBI Accession #: NP_001269476.1
• NCBI GenBank Nucleotide #: NM_001282547.1
• UniProt Accession #: Q8N2I9; Q5VTK8; Q5VTK9; Q6ZMN1; Q8N2J8; Q8N3I6; Q96HN6; Q96I44; Q9BSA3; Q9H7H6; D3DPS8
• Molecular Weight: 49,001 Da
• NCBI Official Full Name: serine/threonine-protein kinase 40 isoform 2
• NCBI Official Synonym Full Names: serine/threonine kinase 40
• NCBI Official Symbol: STK40
• NCBI Official Synonym Symbols: SHIK; SgK495
• NCBI Protein Information: serine/threonine-protein kinase 40; sugen kinase 495; Ser/Thr-like kinase; SINK-homologous serine/threonine-protein kinase
• UniProt Protein Name: Serine/threonine-protein kinase 40
• Protein Family: Serine/threonine-protein kinase
• UniProt Gene Name: STK40
• UniProt Synonym Gene Names: SGK495; SHIK; SgK495
• UniProt Entry Name: STK40_HUMAN

Uniprot Description

Function: May be a negative regulator of NF-kappa-B and p53-mediated gene transcription. Ref.8

Catalytic activity: ATP + a protein = ADP + a phosphoprotein.

Subcellular location: Nucleus. Cytoplasm Ref.8.

Tissue specificity: Strongly expressed in heart, brain, placenta, lung, skeletal muscle, kidney, spleen, thymus, prostate, liver, pancreas, testis, ovary, small intestine, colon and peripheral blood leukocytes. Ref.8

Sequence similarities: Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.Contains 1 protein kinase domain.

Sequence caution: The sequence AAH08344.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB15794.1 differs from that shown. Reason: Erroneous initiation. The sequence BAC11361.1 differs from that shown. Reason: Erroneous initiation.