Mouse anti-Human ST13 Monoclonal Antibody | anti-ST13 antibody

ST13 (Hsc70-interacting Protein, Progesterone Receptor-associated p48 Protein, Protein FAM10A1, Putative Tumor Suppressor ST13, Renal Carcinoma Antigen NY-REN-33, Suppression of Tumorigenicity 13 Protein, FAM10A1, HIP, SNC6, FLJ27260, MGC129952) (MaxLight

Cat. Num. AAA6235563

• Gene Names: ST13; HIP; HOP; P48; AAG2; SNC6; HSPABP; FAM10A1; FAM10A4; HSPABP1; PRO0786
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ST13; Monoclonal Antibody; ST13 (Hsc70-interacting Protein; Progesterone Receptor-associated p48 Protein; Protein FAM10A1; Putative Tumor Suppressor ST13; Renal Carcinoma Antigen NY-REN-33; Suppression of Tumorigenicity 13 Protein; FAM10A1; HIP; SNC6; FLJ27260; MGC129952) (MaxLight; anti-ST13 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2B2
• Specificity: Recognizes human ST13.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.

• Applicable Applications for anti-ST13 antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length recombinant corresponding to aa1-59 from human ST13 (AAH15317) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF*
• Conjugate: MaxLight750
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-ST13 antibody

ST13 is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this protein is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor.

Product Categories/Family for anti-ST13 antibody

Antibodies; Heat Shock Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 15929788
• NCBI GeneID: 6767
• Molecular Weight: 41,332 Da
• NCBI Official Full Name: Homo sapiens suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein), mRNA
• NCBI Official Synonym Full Names: suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
• NCBI Official Symbol: ST13
• NCBI Official Synonym Symbols: HIP; HOP; P48; AAG2; SNC6; HSPABP; FAM10A1; FAM10A4; HSPABP1; PRO0786
• NCBI Protein Information: hsc70-interacting protein
• Protein Family: Hsc70-interacting protein

NCBI Description

The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that it is a candidate tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2013]