Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ST13Sample Tissue: Human THP-1 Whole cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ST13 Polyclonal Antibody | anti-ST13 antibody

ST13 Antibody - middle region

Gene Names
ST13; HIP; HOP; P48; AAG2; SNC6; HSPABP; FAM10A1; FAM10A4; HSPABP1; PRO0786
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ST13; Polyclonal Antibody; ST13 Antibody - middle region; anti-ST13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ERAQREEEARRQSGAQYGSFPGGFPGGMPGNFPGGMPGMGGGMPGMAGMP
Sequence Length
369
Applicable Applications for anti-ST13 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ST13
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ST13Sample Tissue: Human THP-1 Whole cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ST13Sample Tissue: Human THP-1 Whole cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ST13 antibody
The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that it is a candidate tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-ST13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41 kDa
NCBI Official Full Name
hsc70-interacting protein isoform 1
NCBI Official Synonym Full Names
ST13 Hsp70 interacting protein
NCBI Official Symbol
ST13
NCBI Official Synonym Symbols
HIP; HOP; P48; AAG2; SNC6; HSPABP; FAM10A1; FAM10A4; HSPABP1; PRO0786
NCBI Protein Information
hsc70-interacting protein
UniProt Protein Name
Hsc70-interacting protein
Protein Family
UniProt Gene Name
ST13
UniProt Synonym Gene Names
AAG2; FAM10A1; HIP; SNC6; Hip
UniProt Entry Name
F10A1_HUMAN

NCBI Description

The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that it is a candidate tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2013]

Uniprot Description

HIP: One HIP oligomer binds the ATPase domains of at least two HSC70 molecules dependent on activation of the HSC70 ATPase by HSP40. Stabilizes the ADP state of HSC70 that has a high affinity for substrate protein. Through its own chaperone activity, it may contribute to the interaction of HSC70 with various target proteins. Homotetramer. Interacts with HSC70 as well as DNAJ homologs and HSP90. Interacts (via the C-terminus 303- 319 AA) with GRK5. Belongs to the FAM10 family.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: protein complex; cytoplasm; cytosol

Molecular Function: protein binding, bridging; protein domain specific binding; identical protein binding; protein binding; chaperone binding; unfolded protein binding; dATP binding; protein complex binding; Hsp70 protein binding

Biological Process: protein folding; protein homooligomerization

Research Articles on ST13

Similar Products

Product Notes

The ST13 st13 (Catalog #AAA3219840) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ST13 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ST13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ST13 st13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ERAQREEEAR RQSGAQYGSF PGGFPGGMPG NFPGGMPGMG GGMPGMAGMP. It is sometimes possible for the material contained within the vial of "ST13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.