Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human SSH3 Monoclonal Antibody | anti-SSH3 antibody

SSH3 (Protein Phosphatase Slingshot Homolog 3, SSH-like Protein 3, SSH3L, SSH-3L, hSSH-3L) (AP)

Gene Names
SSH3; SSH3L
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SSH3; Monoclonal Antibody; SSH3 (Protein Phosphatase Slingshot Homolog 3; SSH-like Protein 3; SSH3L; SSH-3L; hSSH-3L) (AP); EC=3.1.3.16; EC=3.1.3.48; anti-SSH3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6F9
Specificity
Recognizes human SSH3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
659
Applicable Applications for anti-SSH3 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa293-392 from human SSH3 (NP_060327) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SKEIRQALELRLGLPLQQYRDFIDNQMLLLVAQRDRASRIFPHLYLGSEWNAANLEELQRNRVTHILNMAREIDNFYPERFTYHNVRLWDEESAQLLPH
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of SSH3 expression in transfected 293T cell line by SSH3 monoclonal antibody. Lane 1: SSH3 transfected lysate (73kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SSH3 expression in transfected 293T cell line by SSH3 monoclonal antibody. Lane 1: SSH3 transfected lysate (73kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SSH3 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1-10ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SSH3 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1-10ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SSH3 on A-431 cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SSH3 on A-431 cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SSH3 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SSH3 is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(SSH3 monoclonal antibody, Western Blot analysis of SSH3 expression in A-431.)

Western Blot (WB) (SSH3 monoclonal antibody, Western Blot analysis of SSH3 expression in A-431.)
Product Categories/Family for anti-SSH3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
protein phosphatase Slingshot homolog 3
NCBI Official Synonym Full Names
slingshot protein phosphatase 3
NCBI Official Symbol
SSH3
NCBI Official Synonym Symbols
SSH3L
NCBI Protein Information
protein phosphatase Slingshot homolog 3
UniProt Protein Name
Protein phosphatase Slingshot homolog 3
UniProt Gene Name
SSH3
UniProt Synonym Gene Names
SSH3L; SSH-3L; hSSH-3L
UniProt Entry Name
SSH3_HUMAN

NCBI Description

The ADF (actin-depolymerizing factor)/cofilin family (see MIM 601442) is composed of stimulus-responsive mediators of actin dynamics. ADF/cofilin proteins are inactivated by kinases such as LIM domain kinase-1 (LIMK1; MIM 601329). The SSH family appears to play a role in actin dynamics by reactivating ADF/cofilin proteins in vivo (Niwa et al., 2002 [PubMed 11832213]).[supplied by OMIM, Mar 2008]

Uniprot Description

SSH3: a protein phosphatase which may play a role in the regulation of actin filament dynamics. Can dephosphorylate and activate the actin binding/depolymerizing factor cofilin, which subsequently binds to actin filaments and stimulates their disassembly. Does not bind to, or colocalize with, filamentous actin. Five alternatively spliced isoforms have been described.

Protein type: Protein phosphatase, dual-specificity; Protein phosphatase, Ser/Thr (non-receptor); Phosphatase; Motility/polarity/chemotaxis; EC 3.1.3.48; Cytoskeletal; EC 3.1.3.16

Chromosomal Location of Human Ortholog: 11q13.2

Cellular Component: cytoskeleton; cytoplasm; nucleus

Molecular Function: DNA binding; protein tyrosine/serine/threonine phosphatase activity; protein tyrosine phosphatase activity; actin binding

Biological Process: regulation of actin polymerization and/or depolymerization; regulation of axonogenesis; protein amino acid dephosphorylation

Research Articles on SSH3

Similar Products

Product Notes

The SSH3 ssh3 (Catalog #AAA6133990) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SSH3 (Protein Phosphatase Slingshot Homolog 3, SSH-like Protein 3, SSH3L, SSH-3L, hSSH-3L) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SSH3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SSH3 ssh3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SSH3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.