Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SFRS9 monoclonal antibody. Western Blot analysis of SFRS9 expression in Raw 264.7.)

Mouse anti-Human, Mouse SRSF9 Monoclonal Antibody

SRSF9 (Serine/Arginine-rich Splicing Factor 9, Pre-mRNA-splicing Factor SRp30C, Splicing Factor, Arginine/Serine-rich 9, SFRS9, SRP30C)

Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SRSF9; Monoclonal Antibody; SRSF9 (Serine/Arginine-rich Splicing Factor 9; Pre-mRNA-splicing Factor SRp30C; Splicing Factor; Arginine/Serine-rich 9; SFRS9; SRP30C); Anti -SRSF9 (Serine/Arginine-rich Splicing Factor 9; anti-SRSF9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G7
Specificity
Recognizes human SFRS9. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGG*
Applicable Applications for anti-SRSF9 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1-101 from SFRS9 (NP_003760) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SFRS9 monoclonal antibody. Western Blot analysis of SFRS9 expression in Raw 264.7.)

Western Blot (WB) (SFRS9 monoclonal antibody. Western Blot analysis of SFRS9 expression in Raw 264.7.)

Testing Data

(Detection limit for recombinant GST tagged SFRS9 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SFRS9 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-SRSF9 antibody
Plays a role in constitutive splicing and can modulate the selection of alternative splice sites.
Product Categories/Family for anti-SRSF9 antibody

Similar Products

Product Notes

The SRSF9 (Catalog #AAA6002953) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SRSF9 (Serine/Arginine-rich Splicing Factor 9, Pre-mRNA-splicing Factor SRp30C, Splicing Factor, Arginine/Serine-rich 9, SFRS9, SRP30C) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SRSF9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the SRSF9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSGWADERGG EGDGRIYVGN LPTDVREKDL EDLFYKYGRI REIELKNRHG LVPFAFVRFE DPRDAEDAIY GRNGYDYGQC RLRVEFPRTY GGRGGWPRGG *. It is sometimes possible for the material contained within the vial of "SRSF9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.