Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SFRS9 monoclonal antibody. Western Blot analysis of SFRS9 expression in Raw 264.7.)

Mouse anti-Human, Mouse SRSF9 Monoclonal Antibody | anti-SRSF9 antibody

SRSF9 (Serine/Arginine-rich Splicing Factor 9, Pre-mRNA-splicing Factor SRp30C, Splicing Factor, Arginine/Serine-rich 9, SFRS9, SRP30C) APC

Gene Names
SRSF9; SFRS9; SRp30c
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SRSF9; Monoclonal Antibody; SRSF9 (Serine/Arginine-rich Splicing Factor 9; Pre-mRNA-splicing Factor SRp30C; Splicing Factor; Arginine/Serine-rich 9; SFRS9; SRP30C) APC; anti-SRSF9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G7
Specificity
Recognizes human SFRS9. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SRSF9 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from SFRS9 (NP_003760) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGG*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SFRS9 monoclonal antibody. Western Blot analysis of SFRS9 expression in Raw 264.7.)

Western Blot (WB) (SFRS9 monoclonal antibody. Western Blot analysis of SFRS9 expression in Raw 264.7.)

Testing Data

(Detection limit for recombinant GST tagged SFRS9 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SFRS9 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-SRSF9 antibody
Plays a role in constitutive splicing and can modulate the selection of alternative splice sites.
Product Categories/Family for anti-SRSF9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,542 Da
NCBI Official Full Name
serine/arginine-rich splicing factor 9
NCBI Official Synonym Full Names
serine/arginine-rich splicing factor 9
NCBI Official Symbol
SRSF9
NCBI Official Synonym Symbols
SFRS9; SRp30c
NCBI Protein Information
serine/arginine-rich splicing factor 9; SR splicing factor 9; pre-mRNA-splicing factor SRp30C; splicing factor, arginine/serine-rich 9
UniProt Protein Name
Serine/arginine-rich splicing factor 9
UniProt Gene Name
SRSF9
UniProt Synonym Gene Names
SFRS9; SRP30C
UniProt Entry Name
SRSF9_HUMAN

NCBI Description

The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two pseudogenes, one on chromosome 15 and the other on chromosome 21, have been found for this gene. [provided by RefSeq, Sep 2010]

Uniprot Description

SFRS9: Plays a role in constitutive splicing and can modulate the selection of alternative splice sites. Represses the splicing of MAPT/Tau exon 10. Belongs to the splicing factor SR family.

Protein type: RNA-binding; Spliceosome; RNA splicing

Chromosomal Location of Human Ortholog: 12q24.31

Cellular Component: nucleoplasm; nucleolus

Molecular Function: protein binding; nucleotide binding

Biological Process: transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; mRNA splice site selection; mRNA export from nucleus; negative regulation of nuclear mRNA splicing, via spliceosome; RNA splicing; gene expression; mRNA 3'-end processing; mRNA processing; termination of RNA polymerase II transcription

Research Articles on SRSF9

Similar Products

Product Notes

The SRSF9 srsf9 (Catalog #AAA6139285) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SRSF9 (Serine/Arginine-rich Splicing Factor 9, Pre-mRNA-splicing Factor SRp30C, Splicing Factor, Arginine/Serine-rich 9, SFRS9, SRP30C) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SRSF9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SRSF9 srsf9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SRSF9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.