Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to SP140 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.5ug/ml])

Mouse anti-Human SP140 Monoclonal Antibody | anti-SP140 antibody

SP140 (Speckled 140kD, Nuclear Body Protein SP140, Lymphoid-restricted Homolog of Sp100, LYSp100, Nuclear Autoantigen Sp-140) (PE)

Gene Names
SP140; LYSP100; LYSP100-A; LYSP100-B
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SP140; Monoclonal Antibody; SP140 (Speckled 140kD; Nuclear Body Protein SP140; Lymphoid-restricted Homolog of Sp100; LYSp100; Nuclear Autoantigen Sp-140) (PE); LYSP100-A; LYSP100-B; anti-SP140 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F9
Specificity
Recognizes human SP140.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
3244
Applicable Applications for anti-SP140 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa504-613 from SP140 (NP_009168) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GHGWSRMRMRRQKNSQQNDNSKADGQVVSSEKKANVNLKDLSKIRGRKRGKPGTRFTQSDRAAQKRVRSRASRKHKDETVDFKAPLLPVTCGGVKGILHKKKLQQGILV*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to SP140 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.5ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to SP140 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.5ug/ml])
Product Categories/Family for anti-SP140 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens SP140 nuclear body protein (SP140), transcript variant 1, mRNA
NCBI Official Synonym Full Names
SP140 nuclear body protein
NCBI Official Symbol
SP140
NCBI Official Synonym Symbols
LYSP100; LYSP100-A; LYSP100-B
NCBI Protein Information
nuclear body protein SP140
UniProt Protein Name
Nuclear body protein SP140
Protein Family
UniProt Gene Name
SP140
UniProt Entry Name
SP140_HUMAN

NCBI Description

This gene encodes a member of the SP100 family of proteins, which are share common domains including an N-terminal homogeneously staining region domain followed by a SP100/autoimmune regulator/NucP41/P75/deformed epidermal autoregulatory factor domain, a plant homeobox zinc finger, and a bromodomain. The encoded protein is interferon-inducible and is expressed at high levels in the nuclei of leukocytes. Variants of this gene have been associated with multiple sclerosis, Crohn's disease, and chronic lymphocytic leukemia. Alternative splicing results in multiple variants. [provided by RefSeq, Aug 2016]

Uniprot Description

SP140: Component of the nuclear body, also known as nuclear domain 10, PML oncogenic domain, and KR body. May be involved in the pathogenesis of acute promyelocytic leukemia and viral infection. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 2q37.1

Cellular Component: nucleoplasm; PML body; cytoplasm; nuclear envelope; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; chromatin binding; transcription factor activity

Biological Process: chromatin remodeling; regulation of transcription, DNA-dependent; defense response

Research Articles on SP140

Similar Products

Product Notes

The SP140 sp140 (Catalog #AAA6160454) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SP140 (Speckled 140kD, Nuclear Body Protein SP140, Lymphoid-restricted Homolog of Sp100, LYSp100, Nuclear Autoantigen Sp-140) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SP140 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SP140 sp140 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SP140, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.