Mouse anti-Human SP140 Monoclonal Antibody | anti-SP140 antibody

SP140 (Speckled 140kD, Nuclear Body Protein SP140, Lymphoid-restricted Homolog of Sp100, LYSp100, Nuclear Autoantigen Sp-140) (HRP)

Cat. Num. AAA6155151

• Gene Names: SP140; LYSP100; LYSP100-A; LYSP100-B
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SP140; Monoclonal Antibody; SP140 (Speckled 140kD; Nuclear Body Protein SP140; Lymphoid-restricted Homolog of Sp100; LYSp100; Nuclear Autoantigen Sp-140) (HRP); LYSP100-A; LYSP100-B; anti-SP140 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F9
• Specificity: Recognizes human SP140.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 3244

• Applicable Applications for anti-SP140 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin
• Application Notes: IHC-P: 1.5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa504-613 from SP140 (NP_009168) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GHGWSRMRMRRQKNSQQNDNSKADGQVVSSEKKANVNLKDLSKIRGRKRGKPGTRFTQSDRAAQKRVRSRASRKHKDETVDFKAPLLPVTCGGVKGILHKKKLQQGILV*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to SP140 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.5ug/ml])

Product Categories/Family for anti-SP140 antibody

Antibodies; Nuclear Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 1519244588
• NCBI GeneID: 11262
• NCBI Accession #: NM_007237.5
• NCBI GenBank Nucleotide #: NM_007237
• UniProt Accession #: Q13342
• NCBI Official Full Name: Homo sapiens SP140 nuclear body protein (SP140), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: SP140 nuclear body protein
• NCBI Official Symbol: SP140
• NCBI Official Synonym Symbols: LYSP100; LYSP100-A; LYSP100-B
• NCBI Protein Information: nuclear body protein SP140
• UniProt Protein Name: Nuclear body protein SP140
• Protein Family: Nuclear body protein
• UniProt Gene Name: SP140
• UniProt Entry Name: SP140_HUMAN

NCBI Description

This gene encodes a member of the SP100 family of proteins, which are share common domains including an N-terminal homogeneously staining region domain followed by a SP100/autoimmune regulator/NucP41/P75/deformed epidermal autoregulatory factor domain, a plant homeobox zinc finger, and a bromodomain. The encoded protein is interferon-inducible and is expressed at high levels in the nuclei of leukocytes. Variants of this gene have been associated with multiple sclerosis, Crohn's disease, and chronic lymphocytic leukemia. Alternative splicing results in multiple variants. [provided by RefSeq, Aug 2016]

Uniprot Description

SP140: Component of the nuclear body, also known as nuclear domain 10, PML oncogenic domain, and KR body. May be involved in the pathogenesis of acute promyelocytic leukemia and viral infection. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 2q37.1

Cellular Component: nucleoplasm; PML body; cytoplasm; nuclear envelope; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; chromatin binding; transcription factor activity

Biological Process: chromatin remodeling; regulation of transcription, DNA-dependent; defense response