Immunohistochemistry (IHC)
(Mouse testicle)
Rabbit Tfam Polyclonal Antibody | anti-TFAM antibody
Tfam antibody - C-terminal region
Gene Names
Tfam; Hmgts; mtTFA; tsHMG; AI661103
Reactivity
Cow, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
Tfam; Polyclonal Antibody; Tfam antibody - C-terminal region; anti-TFAM antibody
Host
Rabbit
Reactivity
Cow, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWE
Sequence Length
243
Applicable Applications for anti-TFAM antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 79%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse Tfam
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Mouse testicle)
Immunohistochemistry (IHC)
(Mouse testicle)
Related Product Information for anti-TFAM antibody
This is a rabbit polyclonal antibody against Tfam. It was validated on Western Blot and immunohistochemistry
Target Description: TFAM a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this protein is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns Sayre syndrome was produced when expression of the gene was eliminated by targeted disruption in heart and muscle cells.
Target Description: TFAM a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this protein is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns Sayre syndrome was produced when expression of the gene was eliminated by targeted disruption in heart and muscle cells.
Product Categories/Family for anti-TFAM antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
transcription factor A, mitochondrial
NCBI Official Synonym Full Names
transcription factor A, mitochondrial
NCBI Official Symbol
Tfam
NCBI Official Synonym Symbols
Hmgts; mtTFA; tsHMG; AI661103
NCBI Protein Information
transcription factor A, mitochondrial
UniProt Protein Name
Transcription factor A, mitochondrial
Protein Family
UniProt Gene Name
Tfam
UniProt Synonym Gene Names
Hmgts; mtTFA; TS-HMG
Uniprot Description
Isoform Mitochondrial binds to the mitochondrial light strand promoter and functions in mitochondrial transcription regulation. Required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. Promotes transcription initiation from the HSP1 and the light strand promoter by binding immediately upstream of transcriptional start sites. Is able to unwind DNA. Bends the mitochondrial light strand promoter DNA into a U-turn shape via its HMG boxes. Required for maintenance of normal levels of mitochondrial DNA. May play a role in organizing and compacting mitochondrial DNA. Isoform Nuclear may also function as a transcriptional activator or may have a structural role in the compaction of nuclear DNA during spermatogenesis.
Research Articles on TFAM
Similar Products
Product Notes
The TFAM tfam (Catalog #AAA3203403) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tfam antibody - C-terminal region reacts with Cow, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Tfam can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TFAM tfam for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FQEAKDDSAQ GKLKLVNEAW KNLSPEEKQA YIQLAKDDRI RYDNEMKSWE. It is sometimes possible for the material contained within the vial of "Tfam, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
