Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SOLH on HeLa cell . [antibody concentration 10ug/ml].)

Mouse anti-Human SOLH Monoclonal Antibody | anti-CAPN15 antibody

SOLH (Calpain-15, Small Optic Lobes Homolog, CAPN15, MGC131491)

Gene Names
CAPN15; SOLH
Reactivity
Human
Applications
ELISA, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SOLH; Monoclonal Antibody; SOLH (Calpain-15; Small Optic Lobes Homolog; CAPN15; MGC131491); Anti -SOLH (Calpain-15; anti-CAPN15 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E2
Specificity
Recognizes human SOLH.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL*
Applicable Applications for anti-CAPN15 antibody
ELISA (EL/EIA), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and ELISA.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa993-1087 from human SOLH (NP_005623) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SOLH on HeLa cell . [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SOLH on HeLa cell . [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SOLH is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SOLH is 3ng/ml as a capture antibody.)
Related Product Information for anti-CAPN15 antibody
Widely expressed with higher expression in brain.
Product Categories/Family for anti-CAPN15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
117,314 Da
NCBI Official Full Name
SOLH protein
NCBI Official Synonym Full Names
calpain 15
NCBI Official Symbol
CAPN15
NCBI Official Synonym Symbols
SOLH
NCBI Protein Information
calpain-15; small optic lobes homolog
UniProt Protein Name
Calpain-15
Protein Family
UniProt Gene Name
CAPN15
UniProt Synonym Gene Names
SOLH
UniProt Entry Name
CAN15_HUMAN

NCBI Description

This gene encodes a protein containing zinc-finger-like repeats and a calpain-like protease domain. The encoded protein may function as a transcription factor, RNA-binding protein, or in protein-protein interactions during visual system development. [provided by RefSeq, Jul 2008]

Uniprot Description

SOLH: a protein containing zinc-finger-like repeats and a calpain-like protease domain. The encoded protein may function as a transcription factor, RNA-binding protein, or in protein-protein interactions during visual system development. [provided by RefSeq, Jul 2008]

Protein type: Transcription factor; Protease; EC 3.4.22.-

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: cytoplasm

Molecular Function: peptidase activity; zinc ion binding; calcium-dependent cysteine-type endopeptidase activity; transcription factor activity; cysteine-type peptidase activity

Biological Process: regulation of transcription, DNA-dependent; proteolysis

Similar Products

Product Notes

The CAPN15 capn15 (Catalog #AAA6003743) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SOLH (Calpain-15, Small Optic Lobes Homolog, CAPN15, MGC131491) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SOLH can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Immunofluorescence (IF). Suitable for use in Immunofluorescence and ELISA. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the CAPN15 capn15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HPKAYLHVQC DCTDSFNVVS TRGSLRTQDS VPPLHRQVLV ILSQLEGNAG FSITHRLAHR KAAQAFLSDW TASKGTHSPP LTPEVAGLHG PRPL*. It is sometimes possible for the material contained within the vial of "SOLH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.