Mouse anti-Human SOD3 Monoclonal Antibody | anti-SOD3 antibody

SOD3 (Extracellular Superoxide Dismutase [Cu-Zn], EC-SOD, MGC20077) (Biotin)

Cat. Num. AAA6144526

• Gene Names: SOD3; EC-SOD
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SOD3; Monoclonal Antibody; SOD3 (Extracellular Superoxide Dismutase [Cu-Zn]; EC-SOD; MGC20077) (Biotin); anti-SOD3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Clone Number: 5C3
• Specificity: Recognizes human SOD3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-SOD3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa26-125 from human SOD3 (AAH14418) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGC
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged SOD3 is ~10ng/ml as a capture antibody.)

Related Product Information for anti-SOD3 antibody

Superoxide Dismutases (SODs), originally identified as Indophenoloxidase (IPO), are enzymes that catalyze the conversion of naturally-occuring, but harmful, superoxide radicals into molecular oxygen and hydrogen peroxide. Superoxide Dismutases 3, SOD3, also known as extracellular (EC) SOD, is tetrameric glycoprotein with an apparent subunit molecular weight of about 30kD. Three isoenzymes of SOD have been identified and are functionally related but have very modest sequence homology. SOD3 shares 23%, 17% sequence identity with SOD1 and SOD2, respectively. SOD3 shares ~64% sequence homology with mouse and rat SOD3. Like SOD1, SOD3 binds one Cu2+ and Zn2+ ions per subunit but differs in sequence and tissue distribution. SOD3 is a secretory protein and is synthesized with a putative 18aa signal peptide preceding the 222aa in the mature SOD3. SOD3 is found in plasma, lymph, and synovial fluid as well as in tissues. SOD3 binds on the surface of endothelial cells through the heparan sulfate proteoglycan and eliminates the oxygen radicals from the NADP-dependent oxidative system of neutrophils.

Product Categories/Family for anti-SOD3 antibody

Antibodies; Superoxide Dismutase

NCBI and Uniprot Product Information

• NCBI GI #: 15680149
• NCBI GeneID: 6649
• UniProt Accession #: P08294; Q5U781; Q6FHA2
• Molecular Weight: 25,851 Da
• NCBI Official Full Name: Homo sapiens superoxide dismutase 3, extracellular, mRNA
• NCBI Official Synonym Full Names: superoxide dismutase 3, extracellular
• NCBI Official Symbol: SOD3
• NCBI Official Synonym Symbols: EC-SOD
• NCBI Protein Information: extracellular superoxide dismutase [Cu-Zn]
• UniProt Protein Name: Extracellular superoxide dismutase [Cu-Zn]
• Protein Family: Extracellular superoxide dismutase
• UniProt Gene Name: SOD3
• UniProt Synonym Gene Names: EC-SOD
• UniProt Entry Name: SODE_HUMAN

NCBI Description

This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the conversion of superoxide radicals into hydrogen peroxide and oxygen, which may protect the brain, lungs, and other tissues from oxidative stress. Proteolytic processing of the encoded protein results in the formation of two distinct homotetramers that differ in their ability to interact with the extracellular matrix (ECM). Homotetramers consisting of the intact protein, or type C subunit, exhibit high affinity for heparin and are anchored to the ECM. Homotetramers consisting of a proteolytically cleaved form of the protein, or type A subunit, exhibit low affinity for heparin and do not interact with the ECM. A mutation in this gene may be associated with increased heart disease risk. [provided by RefSeq, Oct 2015]

Uniprot Description

SOD3: Protect the extracellular space from toxic effect of reactive oxygen intermediates by converting superoxide radicals into hydrogen peroxide and oxygen. Belongs to the Cu-Zn superoxide dismutase family.

Protein type: EC 1.15.1.1; Secreted, signal peptide; Oxidoreductase; Secreted

Chromosomal Location of Human Ortholog: 4p15.2

Cellular Component: extracellular matrix; extracellular space; Golgi lumen; cytoplasm; extracellular region; trans-Golgi network; nucleus

Molecular Function: heparin binding; protein binding; copper ion binding; zinc ion binding; superoxide dismutase activity

Biological Process: response to reactive oxygen species; response to copper ion; removal of superoxide radicals; response to hypoxia