Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IFT74 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Rabbit IFT74 Polyclonal Antibody | anti-IFT74 antibody

IFT74 antibody - C-terminal region

Gene Names
IFT74; CMG1; BBS20; CCDC2; CMG-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IFT74; Polyclonal Antibody; IFT74 antibody - C-terminal region; anti-IFT74 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WQHLEQNNFAMKEFIATKSQESDYQPIKKNVTKQIAEYNKTIVDALHSTS
Sequence Length
435
Applicable Applications for anti-IFT74 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IFT74 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Western Blot (WB) (WB Suggested Anti-IFT74 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)
Related Product Information for anti-IFT74 antibody
This is a rabbit polyclonal antibody against IFT74. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-IFT74 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
intraflagellar transport protein 74 homolog isoform a
NCBI Official Synonym Full Names
intraflagellar transport 74
NCBI Official Symbol
IFT74
NCBI Official Synonym Symbols
CMG1; BBS20; CCDC2; CMG-1
NCBI Protein Information
intraflagellar transport protein 74 homolog
UniProt Protein Name
Intraflagellar transport protein 74 homolog
UniProt Gene Name
IFT74
UniProt Synonym Gene Names
CCDC2; CMG1; CMG-1
UniProt Entry Name
IFT74_HUMAN

NCBI Description

This gene encodes a core intraflagellar transport (IFT) protein which belongs to a multi-protein complex involved in the transport of ciliary proteins along axonemal microtubules. IFT proteins are found at the base of the cilium as well as inside the cilium, where they assemble into long arrays between the ciliary base and tip. This protein, together with intraflagellar transport protein 81, binds and transports tubulin within cilia and is required for ciliogenesis. Naturally occurring mutations in this gene are associated with amyotrophic lateral sclerosis--frontotemporal dementia and Bardet-Biedl Syndrome. [provided by RefSeq, Mar 2017]

Uniprot Description

IFT74: 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 9p21.2

Cellular Component: centrosome; cytoplasmic membrane-bound vesicle; nucleus; cilium

Molecular Function: beta-tubulin binding; chromatin binding

Biological Process: Notch signaling pathway; organelle organization and biogenesis; cilium biogenesis; positive regulation of cell adhesion mediated by integrin; positive regulation of transcription from RNA polymerase II promoter; negative regulation of epithelial cell proliferation

Research Articles on IFT74

Similar Products

Product Notes

The IFT74 ift74 (Catalog #AAA3215447) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFT74 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IFT74 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IFT74 ift74 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WQHLEQNNFA MKEFIATKSQ ESDYQPIKKN VTKQIAEYNK TIVDALHSTS. It is sometimes possible for the material contained within the vial of "IFT74, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.