Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.67kD).)

Mouse anti-Human SNAPAP Monoclonal Antibody | anti-SNAPAP antibody

SNAPAP (SNARE-associated Protein Snapin, Biogenesis of Lysosome-related Organelles Complex 1 Subunit 7, BLOC-1 Subunit 7, Synaptosomal-associated Protein 25-binding Protein, SNAP-associated Protein, BLOC1S7, SNAP25BP, SNAPIN) (FITC)

Gene Names
SNAPIN; BLOS7; BORCS3; SNAPAP; BLOC1S7
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SNAPAP; Monoclonal Antibody; SNAPAP (SNARE-associated Protein Snapin; Biogenesis of Lysosome-related Organelles Complex 1 Subunit 7; BLOC-1 Subunit 7; Synaptosomal-associated Protein 25-binding Protein; SNAP-associated Protein; BLOC1S7; SNAP25BP; SNAPIN) (FITC); anti-SNAPAP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3H1
Specificity
Recognizes human SNAPAP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1003
Applicable Applications for anti-SNAPAP antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa41-137 from SNAPAP (NP_036569) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.67kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.67kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SNAPIN on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SNAPIN on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SNAPIN is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SNAPIN is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-SNAPAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens SNAP associated protein (SNAPIN), transcript variant 1, mRNA
NCBI Official Synonym Full Names
SNAP associated protein
NCBI Official Symbol
SNAPIN
NCBI Official Synonym Symbols
BLOS7; BORCS3; SNAPAP; BLOC1S7
NCBI Protein Information
SNARE-associated protein Snapin
UniProt Protein Name
SNARE-associated protein Snapin
UniProt Gene Name
SNAPIN
UniProt Synonym Gene Names
BLOC1S7; SNAP25BP; SNAPAP; BLOC-1 subunit 7; SNAP-associated protein
UniProt Entry Name
SNAPN_HUMAN

NCBI Description

The protein encoded by this gene is a coiled-coil-forming protein that associates with the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex of proteins and the BLOC-1 (biogenesis of lysosome-related organelles) complex. Biochemical studies have identified additional binding partners. As part of the SNARE complex, it is required for vesicle docking and fusion and regulates neurotransmitter release. The BLOC-1 complex is required for the biogenesis of specialized organelles such as melanosomes and platelet dense granules. Mutations in gene products that form the BLOC-1 complex have been identified in mouse strains that are models of Hermansky-Pudlak syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012]

Uniprot Description

SNAPIN: a component of the SNARE complex of proteins that is required for synaptic vesicle docking and fusion. May modulate a step between vesicle priming, fusion and calcium-dependent neurotransmitter release by potentiating the interaction of synaptotagmins with the SNAREs and the plasma-membrane-associated protein SNAP25. Its phosphorylation state influences exocytotic protein interactions and may regulate synaptic vesicle exocytosis. May also have a role in the mechanisms of SNARE-mediated membrane fusion in non-neuronal cells. Phosphorylation by PKA modulates its interaction with the SNARE complex.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: Golgi membrane; Golgi apparatus; synaptic vesicle; transport vesicle; cytoplasmic vesicle membrane; synaptic vesicle membrane; perinuclear region of cytoplasm; nucleolus; synapse; cell junction; secretory granule

Molecular Function: SNARE binding; protein binding

Biological Process: viral reproduction; synaptic vesicle maturation; neurotransmitter secretion; synaptic vesicle transport; synaptic vesicle fusion to presynaptic membrane; intracellular protein transport; synaptic vesicle exocytosis; melanosome organization and biogenesis; regulation of protein binding; anterograde synaptic vesicle transport; endosome to lysosome transport; anterograde axon cargo transport; neurite development

Research Articles on SNAPAP

Similar Products

Product Notes

The SNAPAP snapin (Catalog #AAA6149796) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SNAPAP (SNARE-associated Protein Snapin, Biogenesis of Lysosome-related Organelles Complex 1 Subunit 7, BLOC-1 Subunit 7, Synaptosomal-associated Protein 25-binding Protein, SNAP-associated Protein, BLOC1S7, SNAP25BP, SNAPIN) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNAPAP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SNAPAP snapin for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SNAPAP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.