Mouse anti-Human SNAPAP Monoclonal Antibody | anti-SNAPAP antibody

SNAPAP (SNARE-associated Protein Snapin, Biogenesis of Lysosome-related Organelles Complex 1 Subunit 7, BLOC-1 Subunit 7, Synaptosomal-associated Protein 25-binding Protein, SNAP-associated Protein, BLOC1S7, SNAP25BP, SNAPIN) (Biotin)

Cat. Num. AAA6144493

• Gene Names: SNAPIN; BLOS7; BORCS3; SNAPAP; BLOC1S7
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SNAPAP; Monoclonal Antibody; SNAPAP (SNARE-associated Protein Snapin; Biogenesis of Lysosome-related Organelles Complex 1 Subunit 7; BLOC-1 Subunit 7; Synaptosomal-associated Protein 25-binding Protein; SNAP-associated Protein; BLOC1S7; SNAP25BP; SNAPIN) (Biotin); anti-SNAPAP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3H1
• Specificity: Recognizes human SNAPAP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1003

• Applicable Applications for anti-SNAPAP antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa41-137 from SNAPAP (NP_036569) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.67kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SNAPIN on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SNAPIN is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-SNAPAP antibody

Antibodies; Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 1653961118
• NCBI GeneID: 23557
• NCBI Accession #: NM_012437.6
• NCBI GenBank Nucleotide #: NM_012437
• UniProt Accession #: O95295
• NCBI Official Full Name: Homo sapiens SNAP associated protein (SNAPIN), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: SNAP associated protein
• NCBI Official Symbol: SNAPIN
• NCBI Official Synonym Symbols: BLOS7; BORCS3; SNAPAP; BLOC1S7
• NCBI Protein Information: SNARE-associated protein Snapin
• UniProt Protein Name: SNARE-associated protein Snapin
• UniProt Gene Name: SNAPIN
• UniProt Synonym Gene Names: BLOC1S7; SNAP25BP; SNAPAP; BLOC-1 subunit 7; SNAP-associated protein
• UniProt Entry Name: SNAPN_HUMAN

NCBI Description

The protein encoded by this gene is a coiled-coil-forming protein that associates with the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex of proteins and the BLOC-1 (biogenesis of lysosome-related organelles) complex. Biochemical studies have identified additional binding partners. As part of the SNARE complex, it is required for vesicle docking and fusion and regulates neurotransmitter release. The BLOC-1 complex is required for the biogenesis of specialized organelles such as melanosomes and platelet dense granules. Mutations in gene products that form the BLOC-1 complex have been identified in mouse strains that are models of Hermansky-Pudlak syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012]

Uniprot Description

SNAPIN: a component of the SNARE complex of proteins that is required for synaptic vesicle docking and fusion. May modulate a step between vesicle priming, fusion and calcium-dependent neurotransmitter release by potentiating the interaction of synaptotagmins with the SNAREs and the plasma-membrane-associated protein SNAP25. Its phosphorylation state influences exocytotic protein interactions and may regulate synaptic vesicle exocytosis. May also have a role in the mechanisms of SNARE-mediated membrane fusion in non-neuronal cells. Phosphorylation by PKA modulates its interaction with the SNARE complex.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: Golgi membrane; Golgi apparatus; synaptic vesicle; transport vesicle; cytoplasmic vesicle membrane; synaptic vesicle membrane; perinuclear region of cytoplasm; nucleolus; synapse; cell junction; secretory granule

Molecular Function: SNARE binding; protein binding

Biological Process: viral reproduction; synaptic vesicle maturation; neurotransmitter secretion; synaptic vesicle transport; synaptic vesicle fusion to presynaptic membrane; intracellular protein transport; synaptic vesicle exocytosis; melanosome organization and biogenesis; regulation of protein binding; anterograde synaptic vesicle transport; endosome to lysosome transport; anterograde axon cargo transport; neurite development