Mouse SMAD7 Monoclonal Antibody | anti-SMAD7 antibody

SMAD7 (SMAD Family Member 7, CRCS3, FLJ16482, MADH7, MADH8) (Biotin)

Cat. Num. AAA6173215

• Gene Names: SMAD7; CRCS3; MADH7; MADH8
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: SMAD7; Monoclonal Antibody; SMAD7 (SMAD Family Member 7; CRCS3; FLJ16482; MADH7; MADH8) (Biotin); SMAD Family Member 7; MADH8; anti-SMAD7 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4C11
• Specificity: Recognizes SMAD7.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-SMAD7 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SMAD7 (NP_005895, 160aa-260aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSH
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SMAD7 is 0.03 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SMAD7 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SMAD7 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-SMAD7 antibody

Mouse monoclonal antibody raised against a partial recombinant SMAD7.

Product Categories/Family for anti-SMAD7 antibody

Antibodies; Smad Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 5174517
• NCBI GeneID: 4092
• NCBI Accession #: NP_005895
• NCBI GenBank Nucleotide #: NM_005904
• UniProt Accession #: O15105
• Molecular Weight: 46kDa
• NCBI Official Full Name: mothers against decapentaplegic homolog 7 isoform 1
• NCBI Official Synonym Full Names: SMAD family member 7
• NCBI Official Symbol: SMAD7
• NCBI Official Synonym Symbols: CRCS3; MADH7; MADH8
• NCBI Protein Information: mothers against decapentaplegic homolog 7
• UniProt Protein Name: Mothers against decapentaplegic homolog 7
• Protein Family: Mothers against decapentaplegic
• UniProt Gene Name: SMAD7
• UniProt Synonym Gene Names: MADH7; MADH8; MAD homolog 7; Mothers against DPP homolog 7; MAD homolog 8; Mothers against DPP homolog 8; SMAD 7; Smad7; hSMAD7
• UniProt Entry Name: SMAD7_HUMAN

NCBI Description

The protein encoded by this gene is a nuclear protein that binds the E3 ubiquitin ligase SMURF2. Upon binding, this complex translocates to the cytoplasm, where it interacts with TGF-beta receptor type-1 (TGFBR1), leading to the degradation of both the encoded protein and TGFBR1. Expression of this gene is induced by TGFBR1. Variations in this gene are a cause of susceptibility to colorectal cancer type 3 (CRCS3). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

SMAD7: Antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members; has been shown to inhibit TGF-beta (Transforming growth factor) and activin signaling by associating with their receptors thus preventing SMAD2 access. Functions as an adapter to recruit SMURF2 to the TGF-beta receptor complex. Also acts by recruiting the PPP1R15A- PP1 complex to TGFBR1, which promotes its dephosphorylation. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator. Genetic variations in SMAD7 influence susceptibility to colorectal cancer type 3 (CRCS3). Colorectal cancer consists of tumors or cancer of either the colon or rectum or both. Cancers of the large intestine are the second most common form of cancer found in males and females. Symptoms include rectal bleeding, occult blood in stools, bowel obstruction and weight loss. Treatment is based largely on the extent of cancer penetration into the intestinal wall. Surgical cures are possible if the malignancy is confined to the intestine. Risk can be reduced when following a diet which is low in fat and high in fiber. Belongs to the dwarfin/SMAD family.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 18q21.1

Cellular Component: nucleoplasm; transcription factor complex; protein complex; cell-cell adherens junction; cytoplasm; plasma membrane; catenin complex; cytosol; nucleus

Molecular Function: collagen binding; protein binding; ubiquitin protein ligase binding; metal ion binding; beta-catenin binding; activin binding; transforming growth factor beta receptor, inhibitory cytoplasmic mediator activity; transcription factor activity

Biological Process: transcription initiation from RNA polymerase II promoter; transcription, DNA-dependent; protein stabilization; negative regulation of transcription factor activity; negative regulation of peptidyl-serine phosphorylation; negative regulation of transcription from RNA polymerase II promoter; regulation of activin receptor signaling pathway; negative regulation of BMP signaling pathway; BMP signaling pathway; regulation of transforming growth factor beta receptor signaling pathway; ureteric bud development; positive regulation of protein ubiquitination; transforming growth factor beta receptor signaling pathway; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; negative regulation of ubiquitin-protein ligase activity; positive regulation of cell-cell adhesion; ventricular cardiac muscle morphogenesis; artery morphogenesis; positive regulation of transcription from RNA polymerase II promoter; gene expression; negative regulation of protein ubiquitination; negative regulation of transforming growth factor beta receptor signaling pathway; negative regulation of cell migration

Disease: Colorectal Cancer, Susceptibility To, 3