<
Western Blot (WB)
(CPSF3 monoclonal antibody (M06), clone 1H8. Western Blot analysis of CPSF3 expression in Hela S3 NE.)
Mouse CPSF3 Monoclonal Antibody | anti-CPSF3 antibody
CPSF3 (Cleavage and Polyadenylation Specific Factor 3, 73kD, CPSF, CPSF-73, CPSF73, YSH1) (AP)
Gene Names
CPSF3; CPSF73; CPSF-73
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
CPSF3; Monoclonal Antibody; CPSF3 (Cleavage and Polyadenylation Specific Factor 3; 73kD; CPSF; CPSF-73; CPSF73; YSH1) (AP); Cleavage and Polyadenylation Specific Factor 3; YSH1; anti-CPSF3 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H8
Specificity
Recognizes CPSF3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CPSF3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CPSF3 (NP_057291, 585aa-684aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(CPSF3 monoclonal antibody (M06), clone 1H8. Western Blot analysis of CPSF3 expression in Hela S3 NE.)
Western Blot (WB)
(CPSF3 monoclonal antibody (M06), clone 1H8. Western Blot analysis of CPSF3 expression in Hela S3 NE.)
Western Blot (WB)
(CPSF3 monoclonal antibody (M06), clone 1H8. Western Blot analysis of CPSF3 expression in NIH/3T3.)
Western Blot (WB)
(CPSF3 monoclonal antibody (M06), clone 1H8. Western Blot analysis of CPSF3 expression in NIH/3T3.)
Western Blot (WB)
(CPSF3 monoclonal antibody (M06), clone 1H8. Western Blot analysis of CPSF3 expression in PC-12.)
Western Blot (WB)
(CPSF3 monoclonal antibody (M06), clone 1H8. Western Blot analysis of CPSF3 expression in PC-12.)
Western Blot (WB)
(CPSF3 monoclonal antibody (M06), clone 1H8. Western Blot analysis of CPSF3 expression in Raw 264.7.)
Western Blot (WB)
(CPSF3 monoclonal antibody (M06), clone 1H8. Western Blot analysis of CPSF3 expression in Raw 264.7.)
Related Product Information for anti-CPSF3 antibody
Mouse monoclonal antibody raised against a partial recombinant CPSF3.
Product Categories/Family for anti-CPSF3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
77,486 Da
NCBI Official Full Name
cleavage and polyadenylation specificity factor subunit 3
NCBI Official Synonym Full Names
cleavage and polyadenylation specific factor 3, 73kDa
NCBI Official Symbol
CPSF3
NCBI Official Synonym Symbols
CPSF73; CPSF-73
NCBI Protein Information
cleavage and polyadenylation specificity factor subunit 3; mRNA 3'-end-processing endonuclease CPSF-73
UniProt Protein Name
Cleavage and polyadenylation specificity factor subunit 3
Protein Family
UniProt Gene Name
CPSF3
UniProt Synonym Gene Names
CPSF73; CPSF 73 kDa subunit
UniProt Entry Name
CPSF3_HUMAN
Similar Products
Product Notes
The CPSF3 cpsf3 (Catalog #AAA6163827) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CPSF3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CPSF3 cpsf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CPSF3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
