Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SLC22A18AS is 0.3 ng/ml as a capture antibody.)

Mouse SLC22A18AS Monoclonal Antibody | anti-SLC22A18AS antibody

SLC22A18AS (Solute Carrier Family 22 (organic Cation Transporter), Member 18 antisense, BWR1B, BWSCR1B, ORCTL2S, SLC22A1LS, p27-BWR1B) (AP)

Gene Names
SLC22A18AS; BWR1B; BWSCR1B; ORCTL2S; SLC22A1LS; p27-BWR1B
Applications
Western Blot
Purity
Purified
Synonyms
SLC22A18AS; Monoclonal Antibody; SLC22A18AS (Solute Carrier Family 22 (organic Cation Transporter); Member 18 antisense; BWR1B; BWSCR1B; ORCTL2S; SLC22A1LS; p27-BWR1B) (AP); Solute Carrier Family 22 (organic Cation Transporter); p27-BWR1B; anti-SLC22A18AS antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B1
Specificity
Recognizes SLC22A18AS.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SLC22A18AS antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SLC22A18AS (AAH30237.1, 1aa-150aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRCAEGAWWFSPDGPAGSAASIWPAEGAEGLPGQLGRDRLEVVYSVPDNVPGQNGSRRPLVCKITGKCLSVCSEENAKAGGCSAFPLLLSQLGARMTGREHAHKGPELTTPDSGLPRPPNPALAGFRALAQHSPPLGTSTPSAVLLSAAT
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SLC22A18AS is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC22A18AS is 0.3 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of SLC22A18AS expression in transfected 293T cell line by SLC22A18AS monoclonal antibody (M05), clone 4B1.Lane 1: SLC22A18AS transfected lysate (Predicted MW: 15.4 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SLC22A18AS expression in transfected 293T cell line by SLC22A18AS monoclonal antibody (M05), clone 4B1.Lane 1: SLC22A18AS transfected lysate (Predicted MW: 15.4 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-SLC22A18AS antibody
Mouse monoclonal antibody raised against a full-length recombinant SLC22A18AS.
Product Categories/Family for anti-SLC22A18AS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
15,438 Da
NCBI Official Full Name
SLC22A18AS protein
NCBI Official Synonym Full Names
solute carrier family 22 member 18 antisense
NCBI Official Symbol
SLC22A18AS
NCBI Official Synonym Symbols
BWR1B; BWSCR1B; ORCTL2S; SLC22A1LS; p27-BWR1B
NCBI Protein Information
beckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein

Research Articles on SLC22A18AS

Similar Products

Product Notes

The SLC22A18AS (Catalog #AAA6165407) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLC22A18AS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC22A18AS for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC22A18AS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.