Mouse anti-Human Siglec 6 Monoclonal Antibody | anti-SIGLEC6 antibody

Siglec 6 (Sialic Acid binding Ig-like Lectin 6, Siglec 6, Obesity-binding Protein 1, OB-BP1, CD33 Antigen-like 1, CDw327, CD327, CD33L, CD33L1, OBBP1) (MaxLight 550)

Cat. Num. AAA6213966

• Gene Names: SIGLEC6; CD327; CD33L; OBBP1; CD33L1; CD33L2; CDW327
• Reactivity: Human
• Applications: Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Siglec 6; Monoclonal Antibody; Siglec 6 (Sialic Acid binding Ig-like Lectin 6; Obesity-binding Protein 1; OB-BP1; CD33 Antigen-like 1; CDw327; CD327; CD33L; CD33L1; OBBP1) (MaxLight 550); anti-SIGLEC6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2G6
• Specificity: Recognizes human Siglec 6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

• Applicable Applications for anti-SIGLEC6 antibody: FLISA, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa371-453 from human Siglec 6 with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
• Conjugate: MaxLight550
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen using 133345 (34.87kD).)

Western Blot (WB)

(Western Blot analysis of Siglec 6 expression in transfected 293T cell line using 133345. Lane 1: SIGLEC6 transfected lysate (48.3kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-SIGLEC6 antibody

SIGLEC6 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells by binding to alpha2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. SIGLEC6, which interacts with LEP, is expressed at high levels in placenta (cyto-and syncytiotrophoblastic cells) and at lower levels in spleen, peripheral blood leukocytes (predominantly B-cells) and small intestine. It contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in downmodulation of cellular responses. The phosphorylated ITIM motif binds to the SH2 domain of PTPN6/SHP-1. The gene for SIGLEC6 belongs to the immunoglobulin superfamily.

Product Categories/Family for anti-SIGLEC6 antibody

Antibodies; Lectins

NCBI and Uniprot Product Information

• NCBI GI #: 193794821
• NCBI GeneID: 946
• NCBI Accession #: NP_001236
• NCBI GenBank Nucleotide #: NM_001245
• UniProt Accession #: O43699; O15388; O43700; A8MV71; B2RTS8; C9JBE5; F8WA78
• Molecular Weight: 62.6kDa (563aa) 70-100KDa (SDS-PAGE under reducing conditions.)
• NCBI Official Full Name: sialic acid-binding Ig-like lectin 6 isoform 1
• NCBI Official Synonym Full Names: sialic acid binding Ig like lectin 6
• NCBI Official Symbol: SIGLEC6
• NCBI Official Synonym Symbols: CD327; CD33L; OBBP1; CD33L1; CD33L2; CDW327
• NCBI Protein Information: sialic acid-binding Ig-like lectin 6
• UniProt Protein Name: Sialic acid-binding Ig-like lectin 6
• Protein Family: Sialic acid-binding Ig-like lectin
• UniProt Gene Name: SIGLEC6
• UniProt Synonym Gene Names: CD33L; CD33L1; OBBP1; Siglec-6; OB-BP1

NCBI Description

This gene encodes a member of the SIGLEC (sialic acid binding immunoglobulin-like lectin) family of proteins. The encoded transmembrane receptor binds sialyl-TN glycans and leptin. Placental expression of the encoded protein is upregulated in preeclampsia. [provided by RefSeq, Jul 2016]

Uniprot Description

Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.