Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SHANK1 is 0.03 ng/ml as a capture antibody.)

Mouse SHANK1 Monoclonal Antibody | anti-SHANK1 antibody

SHANK1 (SH3 and Multiple Ankyrin Repeat Domains 1, SPANK-1, SSTRIP, synamon) (FITC)

Gene Names
SHANK1; SSTRIP; SPANK-1; synamon
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
SHANK1; Monoclonal Antibody; SHANK1 (SH3 and Multiple Ankyrin Repeat Domains 1; SPANK-1; SSTRIP; synamon) (FITC); SH3 and Multiple Ankyrin Repeat Domains 1; synamon; anti-SHANK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8F7
Specificity
Recognizes SHANK1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-SHANK1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SHANK1 (NP_057232.2, 2088aa-2161aa) partial recombinant protein with GST tag.
Immunogen Sequence
KPFGAKPLGFWTKFDVADWLEWLGLAEHRAQFLDHEIDGSHLPALTKEDYVDLGVTRVGHRMNIDRALKFFLER
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SHANK1 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SHANK1 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-SHANK1 antibody
Mouse monoclonal antibody raised against a partial recombinant SHANK1.
Product Categories/Family for anti-SHANK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
224,959 Da
NCBI Official Full Name
SH3 and multiple ankyrin repeat domains protein 1
NCBI Official Synonym Full Names
SH3 and multiple ankyrin repeat domains 1
NCBI Official Symbol
SHANK1
NCBI Official Synonym Symbols
SSTRIP; SPANK-1; synamon
NCBI Protein Information
SH3 and multiple ankyrin repeat domains protein 1; OTTHUMP00000174437; OTTHUMP00000174438; SSTR-interacting protein; somatostatin receptor-interacting protein
UniProt Protein Name
SH3 and multiple ankyrin repeat domains protein 1
UniProt Gene Name
SHANK1
UniProt Entry Name
SHAN1_HUMAN

Uniprot Description

SHANK1: Seems to be an adapter protein in the postsynaptic density (PSD) of excitatory synapses that interconnects receptors of the postsynaptic membrane including NMDA-type and metabotropic glutamate receptors via complexes with GKAP/PSD-95 and Homer, respectively, and the actin-based cytoskeleton. Plays a role in the structural and functional organization of the dendritic spine and synaptic junction. Belongs to the SHANK family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: postsynaptic membrane; neuron projection; membrane; cytoplasm; dendrite; plasma membrane; dendritic spine; excitatory synapse; ionotropic glutamate receptor complex; intracellular; cell junction; N-methyl-D-aspartate selective glutamate receptor complex

Molecular Function: protein C-terminus binding; somatostatin receptor binding; identical protein binding; ionotropic glutamate receptor binding; protein binding; protein complex binding; GKAP/Homer scaffold activity; SH3 domain binding

Biological Process: habituation; negative regulation of actin filament bundle formation; synapse maturation; determination of affect; olfactory behavior; long-term memory; righting reflex; cytoskeletal anchoring; adult behavior; protein complex assembly; social behavior; neuromuscular process controlling balance; associative learning

Research Articles on SHANK1

Similar Products

Product Notes

The SHANK1 shank1 (Catalog #AAA6179167) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SHANK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SHANK1 shank1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SHANK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.