Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.66kD).)

Mouse anti-Human SF3A2 Monoclonal Antibody | anti-SF3A2 antibody

SF3A2 (Splicing Factor 3A Subunit 2, PRP11, PRPF11, SF3a66, Spliceosome-associated Protein 62, SAP 62, SAP62)

Gene Names
SF3A2; PRP11; SAP62; PRPF11; SF3a66
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SF3A2; Monoclonal Antibody; SF3A2 (Splicing Factor 3A Subunit 2; PRP11; PRPF11; SF3a66; Spliceosome-associated Protein 62; SAP 62; SAP62); Anti -SF3A2 (Splicing Factor 3A Subunit 2; anti-SF3A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3B6
Specificity
Recognizes human SF3A2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
IGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEK*
Applicable Applications for anti-SF3A2 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in ELISA, Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa112--217 from SF3A2 (NP_009096) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.66kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.66kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SF3A2 on HeLa cell. [antibody concentration 10ug/ml.)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SF3A2 on HeLa cell. [antibody concentration 10ug/ml.)
Product Categories/Family for anti-SF3A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,256 Da
NCBI Official Full Name
splicing factor 3A subunit 2
NCBI Official Synonym Full Names
splicing factor 3a, subunit 2, 66kDa
NCBI Official Symbol
SF3A2
NCBI Official Synonym Symbols
PRP11; SAP62; PRPF11; SF3a66
NCBI Protein Information
splicing factor 3A subunit 2; SAP 62; spliceosome associated protein 62; spliceosome-associated protein 62; pre-mRNA splicing factor SF3A, subunit 2
UniProt Protein Name
Splicing factor 3A subunit 2
Protein Family
UniProt Gene Name
SF3A2
UniProt Synonym Gene Names
SAP62; SAP 62
UniProt Entry Name
SF3A2_HUMAN

NCBI Description

This gene encodes subunit 2 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 2 interacts with subunit 1 through its amino-terminus while the single zinc finger domain of subunit 2 plays a role in its binding to the 15S U2 snRNP. Subunit 2 may also function independently of its RNA splicing function as a microtubule-binding protein. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex.

Subunit structure: Component of splicing factor SF3A which is composed of three subunits; SF3A3/SAP61, SF3A2/SAP62, SF3A1/SAP114. SF3A associates with the splicing factor SF3B and a 12S RNA unit to form the U2 small nuclear ribonucleoproteins complex (U2 snRNP). Identified in the spliceosome C complex. Interacts with HTATSF1. Ref.7 Ref.9

Subcellular location: Nucleus

By similarity.

Sequence similarities: Belongs to the SF3A2 family.Contains 1 matrin-type zinc finger.

Research Articles on SF3A2

Similar Products

Product Notes

The SF3A2 sf3a2 (Catalog #AAA649966) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SF3A2 (Splicing Factor 3A Subunit 2, PRP11, PRPF11, SF3a66, Spliceosome-associated Protein 62, SAP 62, SAP62) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SF3A2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in ELISA, Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the SF3A2 sf3a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IGRPGYKVTK QRDSEMGQQS LLFQIDYPEI AEGIMPRHRF MSAYEQRIEP PDRRWQYLLM AAEPYETIAF KVPSREIDKA EGKFWTHWNR ETKQFFLQFH FKMEK*. It is sometimes possible for the material contained within the vial of "SF3A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.