Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GSTO2 rabbit polyclonal antibody. Western Blot analysis of GSTO2 expression in HeLa.)

Rabbit anti-Human GSTO2 Polyclonal Antibody | anti-GSTO2 antibody

GSTO2 (Glutathione S-transferase omega-2, Glutathione S-transferase omega 2-2, Glutathione-dependent Dehydroascorbate Reductase, Monomethylarsonic Acid Reductase) (AP)

Gene Names
GSTO2; GSTO 2-2; bA127L20.1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GSTO2; Polyclonal Antibody; GSTO2 (Glutathione S-transferase omega-2; Glutathione S-transferase omega 2-2; Glutathione-dependent Dehydroascorbate Reductase; Monomethylarsonic Acid Reductase) (AP); anti-GSTO2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GSTO2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GSTO2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GSTO2, aa1-243 (NP_899062.1).
Immunogen Sequence
MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(GSTO2 rabbit polyclonal antibody. Western Blot analysis of GSTO2 expression in HeLa.)

Western Blot (WB) (GSTO2 rabbit polyclonal antibody. Western Blot analysis of GSTO2 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of GSTO2 expression in transfected 293T cell line by GSTO2 polyclonal antibody. Lane 1: GSTO2 transfected lysate (28.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GSTO2 expression in transfected 293T cell line by GSTO2 polyclonal antibody. Lane 1: GSTO2 transfected lysate (28.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GSTO2 antibody
Exhibits glutathione-dependent thiol transferase activity. Has high dehydroascorbate reductase activity and may contribute to the recycling of ascorbic acid. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA).
Product Categories/Family for anti-GSTO2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,254 Da
NCBI Official Full Name
glutathione S-transferase omega-2 isoform 1
NCBI Official Synonym Full Names
glutathione S-transferase omega 2
NCBI Official Symbol
GSTO2
NCBI Official Synonym Symbols
GSTO 2-2; bA127L20.1
NCBI Protein Information
glutathione S-transferase omega-2; GSTO-2; MMA(V) reductase; monomethylarsonic acid reductase; glutathione S-transferase omega 2-2; glutathione-S-transferase-like protein; bA127L20.1 (novel glutathione-S-transferase); glutathione-dependent dehydroascorbat
UniProt Protein Name
Glutathione S-transferase omega-2
Protein Family
UniProt Gene Name
GSTO2
UniProt Synonym Gene Names
GSTO-2; GSTO 2-2; MMA(V) reductase
UniProt Entry Name
GSTO2_HUMAN

Uniprot Description

GSTO2: Exhibits glutathione-dependent thiol transferase activity. Has high dehydroascorbate reductase activity and may contribute to the recycling of ascorbic acid. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA). Belongs to the GST superfamily. Omega family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Other Amino Acids Metabolism - glutathione; Xenobiotic Metabolism - drug metabolism - cytochrome P450; EC 1.20.4.2; Transferase; EC 2.5.1.18; EC 1.8.5.1; Xenobiotic Metabolism - metabolism by cytochrome P450

Chromosomal Location of Human Ortholog: 10q25.1

Cellular Component: cytosol

Molecular Function: glutathione transferase activity; glutathione dehydrogenase (ascorbate) activity; methylarsonate reductase activity; oxidoreductase activity

Biological Process: vitamin metabolic process; xenobiotic metabolic process; L-ascorbic acid metabolic process; water-soluble vitamin metabolic process

Similar Products

Product Notes

The GSTO2 gsto2 (Catalog #AAA6380440) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSTO2 (Glutathione S-transferase omega-2, Glutathione S-transferase omega 2-2, Glutathione-dependent Dehydroascorbate Reductase, Monomethylarsonic Acid Reductase) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GSTO2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GSTO2 gsto2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GSTO2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.