Mouse anti-Human SET Monoclonal Antibody | anti-SET antibody

SET (SET Nuclear Oncogene, Protein SET, 2PP2A, HLA-DR-associated Protein II, Inhibitor of Granzyme A-activated DNase, IGAAD, I2PP2A, I-2PP2A, IPP2A2, PHAPII, Phosphatase 2A Inhibitor I2PP2A, Template-activating Factor I, TAF-I, TAF-Ibeta) (MaxLight 750)

Cat. Num. AAA6235259

• Gene Names: SET; 2PP2A; IGAAD; MRD58; TAF-I; I2PP2A; IPP2A2; PHAPII; TAF-IBETA
• Reactivity: Human
• Applications: Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SET; Monoclonal Antibody; SET (SET Nuclear Oncogene; Protein SET; 2PP2A; HLA-DR-associated Protein II; Inhibitor of Granzyme A-activated DNase; IGAAD; I2PP2A; I-2PP2A; IPP2A2; PHAPII; Phosphatase 2A Inhibitor I2PP2A; Template-activating Factor I; TAF-I; TAF-Ibeta) (MaxLight 750); anti-SET antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: M1-F5
• Specificity: Recognizes human SET.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
• Sequence Length: 1356

• Applicable Applications for anti-SET antibody: FLISA, Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant protein corresponding to aa1-277 from human SET with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDED
• Conjugate: MaxLight750
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (56.58kD) usingMBS6009385.)

Testing Data

(Detection limit for recombinant GST tagged SET is ~3ng/ml using 133208 as a capture antibody.)

Related Product Information for anti-SET antibody

Multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-induced apoptosis, GZMA cleaves SET, disrupting its binding to NME1 and releasing NME1 inhibition. Isoform 1 and isoform 2 are potent inhibitors of protein phosphatase 2A. Isoform 1 and isoform 2 inhibit EP300/CREBBP and PCAF-mediated acetylation of histones (HAT) and nucleosomes, most probably by masking the accessibility of lysines of histones to the acetylases. The predominant target for inhibition is histone H4. HAT inhibition leads to silencing of HAT-dependent transcription and prevents active demethylation of DNA. Both isoforms stimulate DNA replication of the adenovirus genome complexed with viral core proteins; however, isoform 2 specific activity is higher.

Product Categories/Family for anti-SET antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 21618460
• NCBI GeneID: 6418
• UniProt Accession #: Q01105
• NCBI Official Full Name: Homo sapiens SET nuclear oncogene, mRNA
• NCBI Official Synonym Full Names: SET nuclear proto-oncogene
• NCBI Official Symbol: SET
• NCBI Official Synonym Symbols: 2PP2A; IGAAD; MRD58; TAF-I; I2PP2A; IPP2A2; PHAPII; TAF-IBETA
• NCBI Protein Information: protein SET
• UniProt Protein Name: Protein SET
• Protein Family: Set3 complex
• UniProt Gene Name: SET
• UniProt Synonym Gene Names: IGAAD; I-2PP2A; TAF-I
• UniProt Entry Name: SET_HUMAN

NCBI Description

The protein encoded by this gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT). This inhibition is most likely accomplished by masking histone lysines from being acetylated, and the consequence is to silence HAT-dependent transcription. The encoded protein is part of a complex localized to the endoplasmic reticulum but is found in the nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes. This protein can also enhance DNA replication of the adenovirus genome. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

SET: a potent inhibitor of protein phosphatase 2A involved in apoptosis, transcription, nucleosome assembly and histone binding. The translocation t(6;9)(q21;q34.1) NUP214/CAN is found in some cases of acute undifferentiated leukemia (AUL). Two alternatively spliced isoforms have been described. Isoform 1 and isoform 2 interact directly with each other and with ANP32A within the tripartite INHAT (inhibitor of acetyltransferases) complex. Both isoforms inhibit the acetylation of histones (HAT) and nucleosomes, most probably by masking the accessibility of lysines of histones to the acetylases. The predominant target for inhibition is histone H4. HAT inhibition leads to silencing of HAT-dependent transcription and prevents active demethylation of DNA. Both isoforms stimulate DNA replication of the adenovirus genome complexed with viral core proteins; however, isoform 2 specific activity is higher. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T lymphocyte (CTL)-induced apoptosis, GZMA cleaves SET, disrupting its binding to NME1 and releasing NME1 inhibition.

Protein type: Nuclear receptor co-regulator; DNA-binding; Apoptosis; DNA replication; Oncoprotein; Inhibitor

Chromosomal Location of Human Ortholog: 9q34

Cellular Component: nucleoplasm; protein complex; perinuclear region of cytoplasm; endoplasmic reticulum; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; DNA binding; histone binding; protein phosphatase type 2A regulator activity; protein phosphatase inhibitor activity

Biological Process: nucleosome assembly; nucleosome disassembly; regulation of catalytic activity; negative regulation of catalytic activity; nucleocytoplasmic transport; gene expression; negative regulation of neuron apoptosis; mitotic cell cycle; DNA replication; negative regulation of transcription, DNA-dependent; negative regulation of histone acetylation