Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (69.08kD).)

Mouse anti-Human SERPINI1 Monoclonal Antibody | anti-SERPINI1 antibody

SERPINI1 (PI12, Neuroserpin, Peptidase Inhibitor 12, PI-12, Serpin I1, DKFZp781N13156) (Biotin)

Gene Names
SERPINI1; PI12; neuroserpin
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SERPINI1; Monoclonal Antibody; SERPINI1 (PI12; Neuroserpin; Peptidase Inhibitor 12; PI-12; Serpin I1; DKFZp781N13156) (Biotin); anti-SERPINI1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D10
Specificity
Recognizes human SERPINI1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SERPINI1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa17-411 from human SERPINI1 (AAH18043) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQEEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLYDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (69.08kD).)

Western Blot (WB) (Western Blot detection against Immunogen (69.08kD).)

Western Blot (WB)

(SERPINI1 monoclonal antibody. Western Blot analysis of SERPINI1 expression in HeLa.)

Western Blot (WB) (SERPINI1 monoclonal antibody. Western Blot analysis of SERPINI1 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SERPINI1 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SERPINI1 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SERPINI1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SERPINI1 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-SERPINI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
46,427 Da
NCBI Official Full Name
Homo sapiens serpin peptidase inhibitor, clade I (neuroserpin), member 1, mRNA
NCBI Official Synonym Full Names
serpin family I member 1
NCBI Official Symbol
SERPINI1
NCBI Official Synonym Symbols
PI12; neuroserpin
NCBI Protein Information
neuroserpin
Protein Family

NCBI Description

This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Research Articles on SERPINI1

Similar Products

Product Notes

The SERPINI1 (Catalog #AAA6144298) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SERPINI1 (PI12, Neuroserpin, Peptidase Inhibitor 12, PI-12, Serpin I1, DKFZp781N13156) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINI1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SERPINI1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SERPINI1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.