Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SERPINE2 Monoclonal Antibody | anti-SERPINE2 antibody

SERPINE2 (Glia-derived Nexin, GDN, Peptidase Inhibitor 7, PI-7, Protease Nexin 1, PN-1, Protease Nexin I, Serpin E2, PI7, PN1) (MaxLight 490)

Gene Names
SERPINE2; GDN; PI7; PN1; PNI; PI-7; PN-1; GDNPF
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SERPINE2; Monoclonal Antibody; SERPINE2 (Glia-derived Nexin; GDN; Peptidase Inhibitor 7; PI-7; Protease Nexin 1; PN-1; Protease Nexin I; Serpin E2; PI7; PN1) (MaxLight 490); anti-SERPINE2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G12
Specificity
Recognizes human SERPINE2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-SERPINE2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa72-172 from human SERPINE2 (NP_006207) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRNVNFEDPASACDSINAWVKNETRDMIDNLLSPD
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SERPINE2 antibody
Serine protease inhibitor with activity toward thrombin, trypsin, and urokinase. Promotes neurite extension by inhibiting thrombin. Binds heparin.
Product Categories/Family for anti-SERPINE2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
glia-derived nexin isoform a
NCBI Official Synonym Full Names
serpin family E member 2
NCBI Official Symbol
SERPINE2
NCBI Official Synonym Symbols
GDN; PI7; PN1; PNI; PI-7; PN-1; GDNPF
NCBI Protein Information
glia-derived nexin
UniProt Protein Name
Glia-derived nexin
Protein Family
UniProt Gene Name
SERPINE2
UniProt Synonym Gene Names
PI7; PN1; GDN; PI-7; PN-1
UniProt Entry Name
GDN_HUMAN

NCBI Description

This gene encodes a member of the serpin family of proteins, a group of proteins that inhibit serine proteases. Thrombin, urokinase, plasmin and trypsin are among the proteases that this family member can inhibit. This gene is a susceptibility gene for chronic obstructive pulmonary disease and for emphysema. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]

Uniprot Description

SERPINE2: Serine protease inhibitor with activity toward thrombin, trypsin, and urokinase. Promotes neurite extension by inhibiting thrombin. Binds heparin. Belongs to the serpin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Inhibitor; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 2q36.1

Cellular Component: cell soma; cytosol; extracellular matrix; extracellular region; extracellular space; extrinsic to external side of plasma membrane; neuromuscular junction

Molecular Function: glycosaminoglycan binding; heparin binding; protein binding; receptor binding; serine-type endopeptidase inhibitor activity

Biological Process: blood coagulation; cerebellar granular layer morphogenesis; detection of mechanical stimulus involved in sensory perception; embryo implantation; mating plug formation; negative regulation of blood coagulation; negative regulation of cell growth; negative regulation of cell proliferation; negative regulation of phosphoinositide 3-kinase cascade; negative regulation of proteolysis; negative regulation of smoothened signaling pathway; positive regulation of astrocyte differentiation; regulation of cell migration; regulation of synaptic transmission, glutamatergic; regulation of timing of cell differentiation; response to radiation; secretory granule organization and biogenesis

Research Articles on SERPINE2

Similar Products

Product Notes

The SERPINE2 serpine2 (Catalog #AAA6203230) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SERPINE2 (Glia-derived Nexin, GDN, Peptidase Inhibitor 7, PI-7, Protease Nexin 1, PN-1, Protease Nexin I, Serpin E2, PI7, PN1) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINE2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SERPINE2 serpine2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SERPINE2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.