Mouse anti-Human SERPINE2 Monoclonal Antibody | anti-SERPINE2 antibody

SERPINE2 (Glia-derived Nexin, GDN, Peptidase Inhibitor 7, PI-7, Protease Nexin 1, PN-1, Protease Nexin I, Serpin E2, PI7, PN1) (FITC)

Cat. Num. AAA6149600

• Gene Names: SERPINE2; GDN; PI7; PN1; PNI; PI-7; PN-1; GDNPF
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SERPINE2; Monoclonal Antibody; SERPINE2 (Glia-derived Nexin; GDN; Peptidase Inhibitor 7; PI-7; Protease Nexin 1; PN-1; Protease Nexin I; Serpin E2; PI7; PN1) (FITC); anti-SERPINE2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3G12
• Specificity: Recognizes human SERPINE2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-SERPINE2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa72-172 from human SERPINE2 (NP_006207) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRNVNFEDPASACDSINAWVKNETRDMIDNLLSPD
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.85kD).)

Western Blot (WB)

(Western Blot analysis of SERPINE2 expression in transfected 293T cell line by 133189. Lane 1: SERPINE2 transfected lysate (44.002kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-SERPINE2 antibody

Serine protease inhibitor with activity toward thrombin, trypsin, and urokinase. Promotes neurite extension by inhibiting thrombin. Binds heparin.

Product Categories/Family for anti-SERPINE2 antibody

Antibodies; Protease Inhibitors

NCBI and Uniprot Product Information

• NCBI GI #: 24307907
• NCBI GeneID: 5270
• NCBI Accession #: NP_006207
• NCBI GenBank Nucleotide #: NM_006216
• UniProt Accession #: P07093
• Molecular Weight: 44kDa
• NCBI Official Full Name: glia-derived nexin isoform a
• NCBI Official Synonym Full Names: serpin family E member 2
• NCBI Official Symbol: SERPINE2
• NCBI Official Synonym Symbols: GDN; PI7; PN1; PNI; PI-7; PN-1; GDNPF
• NCBI Protein Information: glia-derived nexin
• UniProt Protein Name: Glia-derived nexin
• Protein Family: Glia-derived nexin
• UniProt Gene Name: SERPINE2
• UniProt Synonym Gene Names: PI7; PN1; GDN; PI-7; PN-1
• UniProt Entry Name: GDN_HUMAN

NCBI Description

This gene encodes a member of the serpin family of proteins, a group of proteins that inhibit serine proteases. Thrombin, urokinase, plasmin and trypsin are among the proteases that this family member can inhibit. This gene is a susceptibility gene for chronic obstructive pulmonary disease and for emphysema. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]

Uniprot Description

SERPINE2: Serine protease inhibitor with activity toward thrombin, trypsin, and urokinase. Promotes neurite extension by inhibiting thrombin. Binds heparin. Belongs to the serpin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Inhibitor; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 2q36.1

Cellular Component: cell soma; cytosol; extracellular matrix; extracellular region; extracellular space; extrinsic to external side of plasma membrane; neuromuscular junction

Molecular Function: glycosaminoglycan binding; heparin binding; protein binding; receptor binding; serine-type endopeptidase inhibitor activity

Biological Process: blood coagulation; cerebellar granular layer morphogenesis; detection of mechanical stimulus involved in sensory perception; embryo implantation; mating plug formation; negative regulation of blood coagulation; negative regulation of cell growth; negative regulation of cell proliferation; negative regulation of phosphoinositide 3-kinase cascade; negative regulation of proteolysis; negative regulation of smoothened signaling pathway; positive regulation of astrocyte differentiation; regulation of cell migration; regulation of synaptic transmission, glutamatergic; regulation of timing of cell differentiation; response to radiation; secretory granule organization and biogenesis