Mouse anti-Human SDHD Monoclonal Antibody | anti-SDHD antibody

SDHD (SDH4, Succinate Dehydrogenase [Ubiquinone] Cytochrome B Small Subunit, Mitochondrial, CII-4, QPs3, Succinate Dehydrogenase Complex Subunit D, Succinate-ubiquinone Oxidoreductase Cytochrome b Small Subunit, Succinate-ubiquinone Reductase Membrane Anc

Cat. Num. AAA6154859

• Gene Names: SDHD; PGL; CBT1; CWS3; PGL1; QPs3; SDH4; cybS; CII-4
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SDHD; Monoclonal Antibody; SDHD (SDH4; Succinate Dehydrogenase [Ubiquinone] Cytochrome B Small Subunit; Mitochondrial; CII-4; QPs3; Succinate Dehydrogenase Complex Subunit D; Succinate-ubiquinone Oxidoreductase Cytochrome b Small Subunit; Succinate-ubiquinone Reductase Membrane Anc; anti-SDHD antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3F4
• Specificity: Recognizes human SDHD.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 1329

• Applicable Applications for anti-SDHD antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa57-161 from human SDHD (AAH09574) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDALQKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL**
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.55kD).)

Related Product Information for anti-SDHD antibody

Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The subunit D protein is one of two integral membrane proteins anchoring the complex to the matrix side of the membrane. Mutations in SDHD have been linked to hereditary paraganglioma.

Product Categories/Family for anti-SDHD antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 16306997
• NCBI GeneID: 6392
• NCBI Official Full Name: Homo sapiens succinate dehydrogenase complex, subunit D, integral membrane protein, mRNA
• NCBI Official Synonym Full Names: succinate dehydrogenase complex subunit D
• NCBI Official Symbol: SDHD
• NCBI Official Synonym Symbols: PGL; CBT1; CWS3; PGL1; QPs3; SDH4; cybS; CII-4
• NCBI Protein Information: succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
• Protein Family: Succinate dehydrogenase

NCBI Description

This gene encodes a member of complex II of the respiratory chain, which is responsible for the oxidation of succinate. The encoded protein is one of two integral membrane proteins anchoring the complex to the matrix side of the mitochondrial inner membrane. Mutations in this gene are associated with the formation of tumors, including hereditary paraganglioma. Transmission of disease occurs almost exclusively through the paternal allele, suggesting that this locus may be maternally imprinted. There are pseudogenes for this gene on chromosomes 1, 2, 3, 7, and 18. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013]