Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SDHDSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SDHD Polyclonal Antibody | anti-SDHD antibody

SDHD Antibody - N-terminal region

Gene Names
SDHD; PGL; CBT1; CWS3; PGL1; QPs3; SDH4; cybS; CII-4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SDHD; Polyclonal Antibody; SDHD Antibody - N-terminal region; anti-SDHD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLG
Sequence Length
159
Applicable Applications for anti-SDHD antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SDHD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SDHDSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SDHDSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SDHD antibody
This is a rabbit polyclonal antibody against SDHD. It was validated on Western Blot

Target Description: This gene encodes a member of complex II of the respiratory chain, which is responsible for the oxidation of succinate. The encoded protein is one of two integral membrane proteins anchoring the complex to the matrix side of the mitochondrial inner membrane. Mutations in this gene are associated with the formation of tumors, including hereditary paraganglioma. Transmission of disease occurs almost exclusively through the paternal allele, suggesting that this locus may be maternally imprinted. There are pseudogenes for this gene on chromosomes 1, 2, 3, 7, and 18. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-SDHD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
succinate dehydrogenase
NCBI Official Synonym Full Names
succinate dehydrogenase complex subunit D
NCBI Official Symbol
SDHD
NCBI Official Synonym Symbols
PGL; CBT1; CWS3; PGL1; QPs3; SDH4; cybS; CII-4
NCBI Protein Information
succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
UniProt Protein Name
Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
Protein Family
UniProt Gene Name
SDHD
UniProt Synonym Gene Names
SDH4; CybS
UniProt Entry Name
DHSD_HUMAN

NCBI Description

This gene encodes a member of complex II of the respiratory chain, which is responsible for the oxidation of succinate. The encoded protein is one of two integral membrane proteins anchoring the complex to the matrix side of the mitochondrial inner membrane. Mutations in this gene are associated with the formation of tumors, including hereditary paraganglioma. Transmission of disease occurs almost exclusively through the paternal allele, suggesting that this locus may be maternally imprinted. There are pseudogenes for this gene on chromosomes 1, 2, 3, 7, and 18. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013]

Uniprot Description

SDHD: Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Defects in SDHD are a cause of paragangliomas type 1 (PGL1). A neural crest tumor usually derived from the chromoreceptor tissue of a paraganglion. PGL1 is a rare autosomal dominant disorder which is characterized by the development of mostly benign, highly vascular, slowly growing tumors in the head and neck. In the head and neck region, the carotid body is the largest of all paraganglia and is also the most common site of the tumors. Defects in SDHD are a cause of susceptibility to pheochromocytoma (PCC). A catecholamine-producing tumor of chromaffin tissue of the adrenal medulla or sympathetic paraganglia. The cardinal symptom, reflecting the increased secretion of epinephrine and norepinephrine, is hypertension, which may be persistent or intermittent. Defects in SDHD may be a cause of susceptibility to intestinal carcinoid tumor (ICT). A yellow, well- differentiated, circumscribed tumor that arises from enterochromaffin cells in the small intestine or, less frequently, in other parts of the gastrointestinal tract. Defects in SDHD are a cause of paraganglioma and gastric stromal sarcoma (PGGSS); also called Carney-Stratakis syndrome. Gastrointestinal stromal tumors may be sporadic or inherited in an autosomal dominant manner, alone or as a component of a syndrome associated with other tumors, such as in the context of neurofibromatosis type 1 (NF1). Patients have both gastrointestinal stromal tumors and paragangliomas. Susceptibility to the tumors was inherited in an apparently autosomal dominant manner, with incomplete penetrance. Defects in SDHD are a cause of Cowden-like syndrome (CWDLS). Cowden-like syndrome is a cancer predisposition syndrome associated with elevated risk for tumors of the breast, thyroid, kidney and uterus. Belongs to the CybS family.

Protein type: Membrane protein, multi-pass; Mitochondrial; Membrane protein, integral; Energy Metabolism - oxidative phosphorylation; Carbohydrate Metabolism - citrate (TCA) cycle

Chromosomal Location of Human Ortholog: 11q23

Cellular Component: mitochondrial envelope; mitochondrial respiratory chain complex II; mitochondrion; mitochondrial inner membrane; integral to membrane

Molecular Function: ubiquinone binding; electron carrier activity; metal ion binding; heme binding; succinate dehydrogenase activity

Biological Process: cellular metabolic process; tricarboxylic acid cycle

Disease: Paraganglioma And Gastric Stromal Sarcoma; Carcinoid Tumors, Intestinal; Cowden Syndrome 3; Paragangliomas 1; Pheochromocytoma

Research Articles on SDHD

Similar Products

Product Notes

The SDHD sdhd (Catalog #AAA3219393) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SDHD Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SDHD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SDHD sdhd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AHISAFLQDR PIPEWCGVQH IHLSPSHHSG SKAASLHWTS ERVVSVLLLG. It is sometimes possible for the material contained within the vial of "SDHD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.