Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged MBNL2 is 0.03ng/ml as a capture antibody.)

Mouse anti-Human MBNL2 Monoclonal Antibody | anti-MBNL2 antibody

MBNL2 (MBLL, MBLL39, MLP1, Muscleblind-like Protein 2, Muscleblind-like Protein 1, Muscleblind-like Protein-like, Muscleblind-like Protein-like 39) APC

Gene Names
MBNL2; MBLL; MBLL39; PRO2032
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MBNL2; Monoclonal Antibody; MBNL2 (MBLL; MBLL39; MLP1; Muscleblind-like Protein 2; Muscleblind-like Protein 1; Muscleblind-like Protein-like; Muscleblind-like Protein-like 39) APC; anti-MBNL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C3
Specificity
Recognizes human MBNL2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
4691
Applicable Applications for anti-MBNL2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-80 from MBNL2 (NP_659002) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MBNL2 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MBNL2 is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-MBNL2 antibody
This gene encodes a C3H-type zinc finger protein, which is similar to the Drosophila melanogaster muscleblind B protein. Drosophila muscleblind is a gene required for photoreceptor differentiation. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined.
Product Categories/Family for anti-MBNL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens muscleblind like splicing regulator 2 (MBNL2), transcript variant 1, mRNA
NCBI Official Synonym Full Names
muscleblind like splicing regulator 2
NCBI Official Symbol
MBNL2
NCBI Official Synonym Symbols
MBLL; MBLL39; PRO2032
NCBI Protein Information
muscleblind-like protein 2
Protein Family

NCBI Description

This gene is a member of the muscleblind protein family which was initially described in Drosophila melanogaster. This gene encodes a C3H-type zinc finger protein that modulates alternative splicing of pre-mRNAs. Muscleblind proteins bind specifically to expanded dsCUG RNA but not to normal size CUG repeats and may thereby play a role in the pathophysiology of myotonic dystrophy. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. [provided by RefSeq, Mar 2012]

Research Articles on MBNL2

Similar Products

Product Notes

The MBNL2 (Catalog #AAA6137549) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MBNL2 (MBLL, MBLL39, MLP1, Muscleblind-like Protein 2, Muscleblind-like Protein 1, Muscleblind-like Protein-like, Muscleblind-like Protein-like 39) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MBNL2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MBNL2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MBNL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.