Western Blot (WB)
(Host: RabbitTarget Name: CCDC91Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human CCDC91 Polyclonal Antibody | anti-CCDC91 antibody
CCDC91 Antibody - middle region
Gene Names
CCDC91; p56; HSD8
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CCDC91; Polyclonal Antibody; CCDC91 Antibody - middle region; anti-CCDC91 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EKGFLKEKEQEAISFQDRYKELQEKHKQELEDMRKAGHEALSIIVDEYKA
Sequence Length
405
Applicable Applications for anti-CCDC91 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CCDC91
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CCDC91Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CCDC91Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CCDC91 antibody
Involved in the regulation of membrane traffic through the trans-Golgi network (TGN). Functions in close cooperation with the GGAs in the sorting of hydrolases to lysosomes.
Product Categories/Family for anti-CCDC91 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44 kDa
NCBI Official Full Name
coiled-coil domain-containing protein 91 isoform 1
NCBI Official Synonym Full Names
coiled-coil domain containing 91
NCBI Official Symbol
CCDC91
NCBI Official Synonym Symbols
p56; HSD8
NCBI Protein Information
coiled-coil domain-containing protein 91
UniProt Protein Name
Coiled-coil domain-containing protein 91
Protein Family
UniProt Gene Name
CCDC91
UniProt Synonym Gene Names
GGABP
UniProt Entry Name
CCD91_HUMAN
Uniprot Description
Function: Involved in the regulation of membrane traffic through the trans-Golgi network (TGN).
Subunit structure: Homodimer. Interacts with GGA1, GGA2 and AP1G1. Ref.1
Subcellular location: Membrane; Peripheral membrane protein. Golgi apparatus › trans-Golgi network membrane; Peripheral membrane protein. Note: Colocalizes with GGA1 and GGA2. May be recruited to the TGN by GGA1 and GGA2. Ref.1
Tissue specificity: Widely expressed. Ref.1
Sequence caution: The sequence BAA91995.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
Research Articles on CCDC91
1. Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
Similar Products
Product Notes
The CCDC91 ccdc91 (Catalog #AAA3222977) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCDC91 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCDC91 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCDC91 ccdc91 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EKGFLKEKEQ EAISFQDRYK ELQEKHKQEL EDMRKAGHEA LSIIVDEYKA. It is sometimes possible for the material contained within the vial of "CCDC91, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
