Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SCNN1G is 1ng/ml as a capture antibody.)

Mouse anti-Human SCNN1G Monoclonal Antibody | anti-SCNN1G antibody

SCNN1G (Amiloride-sensitive Sodium Channel Subunit gamma, Epithelial Na(+) Channel Subunit gamma, ENaCG, Gamma-ENaC, Gamma-NaCH, Nonvoltage-gated Sodium Channel 1 Subunit gamma, SCNEG) (PE)

Gene Names
SCNN1G; PHA1; BESC3; ENaCg; SCNEG; ENaCgamma
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SCNN1G; Monoclonal Antibody; SCNN1G (Amiloride-sensitive Sodium Channel Subunit gamma; Epithelial Na(+) Channel Subunit gamma; ENaCG; Gamma-ENaC; Gamma-NaCH; Nonvoltage-gated Sodium Channel 1 Subunit gamma; SCNEG) (PE); anti-SCNN1G antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F3
Specificity
Recognizes human SCNN1G.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SCNN1G antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa101-201 from human SCNN1G (NP_001030) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQ*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SCNN1G is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SCNN1G is 1ng/ml as a capture antibody.)
Related Product Information for anti-SCNN1G antibody
The Epithelial Sodium Channel (ENaC) is a membrane ion channel permeable to Na+ ions. It is located in the apical plasma membrane of epithelia in the kidneys, lung, colon, and other tissues where it plays a role in transepithelial Na+-ion transport. Specifically Na+ transport via ENaC occurs across many epithelial surfaces, and plays a key role in regulating salt and water absorption. ENaCs are composed of three structurally related subunits that form a tetrameric channel, a, B, and y. The expression of its alpha and beta subunits is enhanced as keratinocytes differentiate. The beta and gamma-ENaC subunits are essential for edema fluid to exert its maximal effect on net fluid absorption by distal lung epithelia. And it has been concluded that the subunits are differentially expressed in the retina of mice with ocular hypertension, therefore the up-regulation of alpha-ENaC proteins could serve as a protection mechanism against elevated intraocular pressure.
Product Categories/Family for anti-SCNN1G antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74,270 Da
NCBI Official Full Name
amiloride-sensitive sodium channel subunit gamma
NCBI Official Synonym Full Names
sodium channel, non-voltage-gated 1, gamma subunit
NCBI Official Symbol
SCNN1G
NCBI Official Synonym Symbols
PHA1; BESC3; ENaCg; SCNEG; ENaCgamma
NCBI Protein Information
amiloride-sensitive sodium channel subunit gamma; gamma-ENaC; gamma-NaCH; ENaC gamma subunit; epithelial Na(+) channel subunit gamma; sodium channel, nonvoltage-gated 1, gamma; nonvoltage-gated sodium channel 1 subunit gamma; amiloride-sensitive sodium ch
UniProt Protein Name
Amiloride-sensitive sodium channel subunit gamma
UniProt Gene Name
SCNN1G
UniProt Synonym Gene Names
ENaCG; Gamma-ENaC
UniProt Entry Name
SCNNG_HUMAN

NCBI Description

Nonvoltage-gated, amiloride-sensitive, sodium channels control fluid and electrolyte transport across epithelia in many organs. These channels are heteromeric complexes consisting of 3 subunits: alpha, beta, and gamma. This gene encodes the gamma subunit, and mutations in this gene have been associated with Liddle syndrome. [provided by RefSeq, Apr 2009]

Uniprot Description

ENaC-gamma: Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception. Defects in SCNN1G are a cause of Liddle syndrome (LIDDS). It is an autosomal dominant disorder characterized by pseudoaldosteronism and hypertension associated with hypokalemic alkalosis. The disease is caused by constitutive activation of the renal epithelial sodium channel. Defects in SCNN1G are the cause of bronchiectasis with or without elevated sweat chloride type 3 (BESC3). A debilitating respiratory disease characterized by chronic, abnormal dilatation of the bronchi and other cystic fibrosis-like symptoms in the absence of known causes of bronchiectasis (cystic fibrosis, autoimmune diseases, ciliary dyskinesia, common variable immunodeficiency, foreign body obstruction). Clinical features include sub-normal lung function, sinopulmonary infections, chronic productive cough, excessive sputum production, and elevated sweat chloride in some cases. Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1G subfamily.

Protein type: Channel, sodium; Membrane protein, multi-pass; Transporter, ion channel; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16p12

Cellular Component: integral to plasma membrane; apical plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: amiloride-sensitive sodium channel activity; protein binding; WW domain binding; sodium channel activity

Biological Process: sensory perception of taste; response to stimulus; sodium ion transport; sodium ion homeostasis; multicellular organismal water homeostasis; excretion; transmembrane transport

Disease: Bronchiectasis With Or Without Elevated Sweat Chloride 3; Pseudohypoaldosteronism, Type I, Autosomal Recessive; Liddle Syndrome

Research Articles on SCNN1G

Similar Products

Product Notes

The SCNN1G scnn1g (Catalog #AAA6160151) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SCNN1G (Amiloride-sensitive Sodium Channel Subunit gamma, Epithelial Na(+) Channel Subunit gamma, ENaCG, Gamma-ENaC, Gamma-NaCH, Nonvoltage-gated Sodium Channel 1 Subunit gamma, SCNEG) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SCNN1G can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SCNN1G scnn1g for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SCNN1G, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.